KEGG   Vibrio cholerae IEC224: O3Y_11315Help
Entry
O3Y_11315         CDS       T01766                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vci  Vibrio cholerae IEC224
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    O3Y_11315
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3Y_11315
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    O3Y_11315
Enzymes [BR:vci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     O3Y_11315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:complement(2563895..2565175)
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAQLPKFDDIDALLAEDFVSRSSKILSAL
IGDELPADKIRAMVDSAFQFAAPIAKVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
NGGKITILTATSGDTGAAVAHAFYGMPDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELRQQIGLNSANSINISRLMAQICYYFEAAAQMSKAERENLV
ISVPSGNFGNLTAGLLAKALGLPVKRFIAATNANDTVPRYLETGRWEPKPTVATTSNAMD
VSQPNNWPRIEELCQRMGWGLETLGKGAVSDEESAQAVQELYDLGYLCEPHGSIAYRVLE
EQRQPQETGLFLCTAHPAKFKEVVDDILGTDIALPAPLAKHAAMELLSQELNADFAALRA
LLVNVK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacaacataaaagaaaatgatgaacaagtctcctttggtcaagccgttcgc
caagggttaggccgcaatcaaggcctgttttttccggcacaattgccgaagtttgacgat
attgatgctctattggccgaagatttcgtctctcgtagcagcaagattttatcggcgttg
attggcgatgaactgcctgcggataaaattcgcgctatggtggattccgcctttcaattc
gccgcaccgattgccaaagtgaaagagggcgtttacgcgctcgaattgttccacgggcca
acgctcgcgtttaaagattttggtggtcgctttatggcccagtctctggcggcggtctcg
aacggcggaaaaatcacgattttgacggcgacatccggtgataccggcgctgctgttgcg
cacgcattttatggtatgccagacattaatgtggtgatcctttatccgaaaggaaaaatc
agtccgctgcaagaaaagctgttctgcacattaggtaaaaacattcacaccgtggcgatc
aatggcgattttgatgcttgccaagcactagtgaaacaagcttttgatgacgcagagctg
cgccaacagataggtttgaactctgccaactcaattaacatcagccgtttgatggcacaa
atctgttactactttgaagccgctgcgcagatgagcaaagctgagcgtgaaaatctggtg
atttcagtgcctagtggcaactttggtaacttaaccgcagggctgttagccaaagcactg
ggtttaccggtgaagcgctttattgcggcaaccaatgccaacgatacagtgccacgttac
ttggaaacgggacgttgggaacccaaacccacggtagcaacaacgtcaaatgcgatggat
gtcagccaaccgaacaactggccgcgtatcgaagagctctgccaacgtatgggatggggc
ttagaaacgctgggcaaaggcgcggtttctgacgaggaaagtgcgcaagccgtacaagaa
ctttacgatctaggctacttgtgtgaaccgcatggttcgattgcttaccgtgtattggaa
gagcagcgccagccgcaagaaacggggctgttcttatgtaccgcgcatcccgccaaattc
aaagaagtggtggacgatattttaggtaccgacattgctctaccagcgccattggcaaaa
catgcggcgatggaattgctctcacaagagctgaatgccgatttcgcagcgctgcgtgcg
ttactggtgaatgtgaaataa

DBGET integrated database retrieval system