KEGG   Vibrio cholerae IEC224: O3Y_11580Help
Entry
O3Y_11580         CDS       T01766                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vci  Vibrio cholerae IEC224
Brite
Enzymes [BR:vci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     O3Y_11580
Secretion system [BR:vci02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   O3Y_11580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2638905..2639657)
Genome map
AA seq 250 aa AA seqDB search
MSVLRRLTWLAFPLLSMAFNVQANTAPAQLNKAELEQRFAKLGLQVEEIKTSDINGLLEV
QTSGGVLFSSPDGEHFIAGTLYALDGNGGYVDVLAKRQAPLNAKKIAALQDSMIEFKAPN
EKYAITVFTDITCGYCVRLHSQIKEYNDLGITVRYLAYPRQGPQGQVADQMAAIWCSNDP
KAAMHDAKVNRKTITADKDIAQCQKTIAQHYMLGHELGISGTPAIFLPNGEMVGGYLPAP
QLLQRLQATQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtactgcgccgactaacatggctggcatttcctttactgagtatggcattcaac
gtacaagcgaacactgcaccagcacaattgaataaagccgagcttgagcagcgctttgcc
aaactcggattgcaagtggaagagataaaaacctctgatatcaatggcttgcttgaagtg
caaacgtctggtggtgtgttgttctcttcgcctgatggtgagcactttatcgcgggtact
ctgtatgcgctggatggtaatggcggttatgttgatgtgctggctaaacgccaagcgcca
ctcaacgccaagaaaattgccgcattgcaagacagcatgattgagtttaaagcgcccaat
gagaaatacgcgatcaccgtatttaccgatatcacgtgtggttactgtgtgcgtctgcac
agccagatcaaagagtacaatgatctcggcattacggtgcgttatctcgcctacccgcgt
caggggccgcaaggtcaagtcgcggatcaaatggcggccatctggtgttctaacgatccg
aaagcggcgatgcacgatgcgaaagtgaatcgtaaaaccattaccgccgataaagatatc
gcccaatgccaaaagaccatcgcgcagcactatatgctgggtcacgagctcggcattagc
ggtactccagcgattttcttacccaatggtgagatggttggcggctatttgcctgcgccg
caattgctgcaacgcctgcaagccacacaatag

DBGET integrated database retrieval system