KEGG   Vibrio cholerae IEC224: O3Y_12860Help
Entry
O3Y_12860         CDS       T01766                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00010  Glycolysis / Gluconeogenesis
vci00030  Pentose phosphate pathway
vci00051  Fructose and mannose metabolism
vci00052  Galactose metabolism
vci00680  Methane metabolism
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01120  Microbial metabolism in diverse environments
vci01130  Biosynthesis of antibiotics
vci01200  Carbon metabolism
vci01230  Biosynthesis of amino acids
vci03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3Y_12860
   00030 Pentose phosphate pathway
    O3Y_12860
   00051 Fructose and mannose metabolism
    O3Y_12860
   00052 Galactose metabolism
    O3Y_12860
  Energy metabolism
   00680 Methane metabolism
    O3Y_12860
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    O3Y_12860
Enzymes [BR:vci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     O3Y_12860
Protein phosphatases and associated proteins [BR:vci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     O3Y_12860
Messenger RNA biogenesis [BR:vci03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     O3Y_12860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFC59442
Position
I:complement(2903085..2904047)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDRIKQLDRSSVSD
VINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMGAKKLTEMGFPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLTLT
SAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDANKLAKEIESATG
RETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQKEQLVHHDIIDA
IENMKRPVRTDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgttttgacgagtggtggcgatgccccaggtatgaatgcagct
attcgcggcgtggtgcgtacagcacttggcgcaggtttagaagtgtttggtatttacgac
ggctaccaaggtctgtacgaagatcgtattaagcagctagaccgttcaagcgtgtctgac
gtgatcaaccgtggcggtacttttttaggctctgcacgcttcccacaatttcgtgaagtt
gaagtgcgcgaaaaagcgattgaaaacctgaaaaagcacggcattgaagcgctggttgtg
attggtggtgacggctcttacatgggcgccaaaaaactgaccgaaatgggtttcccttgt
atcggtctgccaggcacgattgataacgatatcgcgggcaccgactacaccatcggttat
ttgactgccctgaacaccgttattgaagcgattgaccgtctgcgcgatacctcttcttca
caccaacgtatctctatcgtagaaatcatgggtcgtcactgtggtgacttgacgctgacc
tctgcgattgcgggtggctgtgaatacatcatcacaccggaaacgggtctgaatatggag
cagctgatttccaatatcaaagatggtattgcgaaaggcaaaaagcacgcgatcattgcg
ctgactgagctgatgatggatgccaacaaactggccaaagagattgaatcggcgacaggc
cgtgaaactcgcgcaactgtattaggccatattcaacgtggtggtaaacctaccgcattt
gaccgtgtactggcatcgcgcatgggtaactacgcggtgcatctattgatggaaggtcac
ggtggtcgttgtgtgggtatccagaaagagcaactggttcaccacgacatcattgatgcg
attgaaaacatgaagcgtcctgtacgcactgacctgtacaaagtcgctgaagagctgttc
taa

DBGET integrated database retrieval system