KEGG   Vibrio cholerae IEC224: O3Y_12860Help
Entry
O3Y_12860         CDS       T01766                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vci  Vibrio cholerae IEC224
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3Y_12860
   01230 Biosynthesis of amino acids
    O3Y_12860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3Y_12860
   00030 Pentose phosphate pathway
    O3Y_12860
   00051 Fructose and mannose metabolism
    O3Y_12860
   00052 Galactose metabolism
    O3Y_12860
  Energy metabolism
   00680 Methane metabolism
    O3Y_12860
Enzymes [BR:vci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     O3Y_12860
Protein phosphatases and associated proteins [BR:vci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     O3Y_12860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2903085..2904047)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDRIKQLDRSSVSD
VINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMGAKKLTEMGFPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLTLT
SAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDANKLAKEIESATG
RETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQKEQLVHHDIIDA
IENMKRPVRTDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgttttgacgagtggtggcgatgccccaggtatgaatgcagct
attcgcggcgtggtgcgtacagcacttggcgcaggtttagaagtgtttggtatttacgac
ggctaccaaggtctgtacgaagatcgtattaagcagctagaccgttcaagcgtgtctgac
gtgatcaaccgtggcggtacttttttaggctctgcacgcttcccacaatttcgtgaagtt
gaagtgcgcgaaaaagcgattgaaaacctgaaaaagcacggcattgaagcgctggttgtg
attggtggtgacggctcttacatgggcgccaaaaaactgaccgaaatgggtttcccttgt
atcggtctgccaggcacgattgataacgatatcgcgggcaccgactacaccatcggttat
ttgactgccctgaacaccgttattgaagcgattgaccgtctgcgcgatacctcttcttca
caccaacgtatctctatcgtagaaatcatgggtcgtcactgtggtgacttgacgctgacc
tctgcgattgcgggtggctgtgaatacatcatcacaccggaaacgggtctgaatatggag
cagctgatttccaatatcaaagatggtattgcgaaaggcaaaaagcacgcgatcattgcg
ctgactgagctgatgatggatgccaacaaactggccaaagagattgaatcggcgacaggc
cgtgaaactcgcgcaactgtattaggccatattcaacgtggtggtaaacctaccgcattt
gaccgtgtactggcatcgcgcatgggtaactacgcggtgcatctattgatggaaggtcac
ggtggtcgttgtgtgggtatccagaaagagcaactggttcaccacgacatcattgatgcg
attgaaaacatgaagcgtcctgtacgcactgacctgtacaaagtcgctgaagagctgttc
taa

DBGET integrated database retrieval system