KEGG   Vibrio cholerae IEC224: O3Y_13025Help
Entry
O3Y_13025         CDS       T01766                                 

Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vci  Vibrio cholerae IEC224
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vci00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2942329..2943156
Genome map
AA seq 275 aa AA seqDB search
MSTPQDLSHLLPDVINIARAAGQLILDIYQNKSYEAFTKSDSTPVTSADLAAHKFLCEQL
RELTPDIPILSEEEANIDLATRETWQRYWLVDPLDGTQEFIARSGDFATIIALVENNHPV
MGVVYGPVSGVTYYAYAGKGAWKIPDMAQSLKIQTHKHELPSSSIAIAISRRQDINKITR
RLSSAWNYDLVPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILSTQ
LSPLSYNERETLENPNFIVLGDADLPWNEILKIKD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaccacaggatctctcgcacttactgcccgatgtcattaacatcgcgcgagcg
gcagggcaactcatcctcgatatctatcaaaataaatcttatgaagccttcaccaaaagt
gattcaacgcctgtcaccagcgccgatttagccgcacataagtttctgtgtgagcagttg
cgcgagctgacccctgatattccgatcctctcggaggaagaagccaatatcgaccttgcc
actcgcgaaacatggcagcgctattggctggtggatccgctggatggcactcaagagttc
atcgcacgtagcggcgacttcgcgaccatcattgcgctcgtggaaaataaccatccggtg
atgggggtggtgtatggccccgtttctggtgtgacttactacgcttacgcaggcaaaggg
gcgtggaagatccccgacatggcgcagagcctcaaaattcagactcacaaacatgagctg
ccgagcagctcgatcgcgattgccatcagccgtcgccaagacatcaacaaaatcacgcgc
cgtttaagcagtgcttggaattatgacttggtgccactgggctctgcagcactgaaagcc
tgcttagtggcagaaggtgcggtagattgctatctgcgccttggtccaactggcgaatgg
gataccgccgcaacccagtgcattgtcgaagaagcgggtgggcgcattctgagcactcaa
ttatcgcccctctcgtacaatgagcgggaaaccttggaaaacccgaacttcatcgtgctt
ggtgatgcggatttaccttggaatgagatcttaaaaatcaaagactag

DBGET integrated database retrieval system