KEGG   Vibrio cholerae IEC224: O3Y_13563Help
Entry
O3Y_13563         CDS       T01766                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vci  Vibrio cholerae IEC224
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3Y_13563 (malQ)
Enzymes [BR:vci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     O3Y_13563 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:14810..16990
Genome map
AA seq 726 aa AA seqDB search
MNQDNALKQVAAMAKIADRYVSAWGSEAQVEDDTIRRLLASLGYDTSSDDALLQSAEKKH
KKDVVDPVLVVHQGSAIEVPLYLGVSARESEFDWRLQTEQGEVLEGYLQSQIVRDERAEG
GPLVFALPNDLPLGYHTLLIARKRRKAPYEMTLIVTPQACYKQPALAQGKKLWGPSVQLY
TLRTQHNWGMGDFGDLKQLVADIASRGGDFVGLNPIHALFPANPEGASPYSPSSRRWLNI
LYIDVSSVPEFALSAEAQQKVGSPEFQQRLQKVRDAHWVNYSEVAELKMSVLPLLFAEFK
KRHLDKQTDRAHAFLKFVEEGGESLLHQAAFDALHAELHAQDASVWGWPVFPEKYRRFDN
SAVQKFIEDHQDAVHIYMYLQWIADTQIHEVQSLAEEKGMAVGLYRDLAVGVADSGSETW
ADHGNLLQDVSIGAPPDVLGPLGQNWGLPPLNPQALQATAYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGENATKGAYIYYPVKDMLAILALESHRHQCSVIGEDLGTVPDEIVE
LLRDAGVHSYKVFFFETSKEDGGYVSPAHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEEQLQGLFDDRLKSKQGILDSVAWHGYLPDGVGRDATQVPMDSYLSEALQLHVA
AGSSALLSVQLEDWLEMDKPVNIPGTVNEYPNWRRKLSMNLDEIFAREEVNRIAARLTEV
RSKARQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagacaatgcattaaaacaagtcgctgcaatggcaaaaattgccgatcgatat
gtcagcgcgtggggcagtgaagctcaagtggaagacgacacgatccgtcgtcttttggcg
tctcttggctacgataccagcagcgatgacgccttgctgcaatcggcagagaagaaacac
aaaaaagatgtggtggatccggtactcgttgtacaccaaggttcggcgatcgaagtcccg
ctctaccttggcgtgagtgcgcgcgaaagcgaatttgattggcgcttgcagaccgagcaa
ggcgaggtgctggaaggctatctgcaatcacaaattgtacgtgatgaacgtgccgaaggc
ggcccactggtgtttgctctgcctaacgatctgccgctcggttatcacaccttattgatt
gcccgtaagcgtcgcaaagcaccttacgaaatgaccctgattgtgacgccacaagcttgc
tacaagcaaccagctttggcacaaggcaaaaagctgtggggaccgagcgttcaactttat
accctgcgtacccagcacaactggggcatgggagactttggtgatttgaaacagctcgtg
gcggatattgcatcacgcggtggcgattttgttggcttaaacccgatccatgcgctgttt
ccagccaacccagagggcgcaagcccgtacagcccatcctctcgccgttggctcaacatt
ctgtacattgatgtgagctcagtacctgaatttgcactcagcgccgaagcgcagcaaaaa
gtgggtagcccagaattccagcagcgcctccaaaaagtgcgtgatgcccattgggtaaac
tacagcgaagtggctgagcttaaaatgagcgtcttacctctgctgtttgccgaatttaaa
aaacgtcatctggataagcagaccgatcgcgcgcacgcgttcttaaagtttgtggaagag
ggcggagaaagcttgctgcatcaagccgcgtttgatgcgctgcatgccgagttacatgca
caagatgcgtcggtgtggggctggcctgttttcccagagaaatatcgccgttttgataac
agtgcggtacaaaaatttattgaagatcatcaagatgcggtgcacatctacatgtactta
cagtggattgccgatactcagatccacgaagtgcaatcattggccgaagaaaaaggtatg
gcagttggcttataccgcgatctcgccgttggcgtggctgattctggtagtgaaacgtgg
gccgatcacggtaacttgttgcaagatgtcagcattggtgcaccgccggatgtattgggg
cctttggggcaaaactggggcttaccgccactcaacccacaggcgcttcaagccacggcg
tatgacgcgtacatcaaattgctgcgtgccaacatgaagcactgcggagccttgcgtatc
gaccatgtactgggtttgctgcgtttatggtggatcccgaaaggcgaaaacgcgacgaaa
ggcgcgtacatttactacccagtcaaagatatgttagcgattttggcgcttgaatctcac
cgtcaccagtgcagcgtaattggcgaagatctgggaaccgtaccggatgaaatcgtcgag
ctgctgcgcgatgcgggcgtgcattcgtacaaagtgttcttcttcgaaacgtcgaaagaa
gatggcggttacgtttctccggcgcattacgcagagcaatccatggcggcactctgtacc
catgacatgccaaccctgcgcggtttctggcactgtgatgatcttaaaatgggacgtgaa
ataggcctctatcccgatgaagagcagctgcaaggcttgtttgacgatcgcctgaaatcc
aaacagggcattctcgattcagtggcgtggcacggctatttgccggatggcgttggacgt
gatgcgactcaggttccgatggattcctacttgagcgaagcactgcaactgcatgtggcg
gcaggctcttccgcgttactgagcgtgcagttggaagattggttagagatggataagcca
gtcaatattccgggaactgtcaatgaatacccgaactggcgacgtaagttatcgatgaat
ctggacgagatttttgcgcgtgaagaagtgaaccgcattgcggcacgtctgaccgaagtg
cgcagcaaagccagacaataa

DBGET integrated database retrieval system