KEGG   Vibrio cholerae IEC224: O3Y_13568Help
Entry
O3Y_13568         CDS       T01766                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vci  Vibrio cholerae IEC224
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vci00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:17196..19385
Genome map
AA seq 729 aa AA seqDB search
MKITKKPSKVQQFYDQLARAAFADPFSFLGPYIPAEQGALRVWMPGADNVALVVEGQARV
ALEREGEGGFVLKDGRNLRFTHYQLAVDWAGTEQLLDDPYQYHGLYAEYEDLHTPKQMYH
HMGAQFVTLERDGKMVSGVRFLVYAPHAAACSLIGAFNHWDGRRHPMQRLDYGIWGIFIP
GLPEGTQYKFELKGPHGEGLPHKADPWGFYAEQYPSFASVTYDHRRYQWQDTAWQQRPVT
EKRKQALSFYELHVGSWKRGENGEFLNYRELADQLVPYLVEMGYTHVELMPVAEHPFYGS
WGYQPVGLFAPTSRYGSPDDFKYFVDLCHQAGIGVVLDWVPAHFPSDSHGLANFDGTPLF
HDPDPRRGWHQDWNSYIYDLGREHVRRFLVANALYWFEMFHIDGIRVDAVASMLYLDYSR
SHDQWIPNVDGGRENYDAIATFKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGF
GFKWNMGWMHDSLSYIKEDPVHRKYHHNTLTFPLIYAFSENYVLSLSHDEVVYGKRSLMY
KMPGDEWQQTANLRAYLGYMYGQPGKKLNFMGTELGQTAEWDHDGQLQWFLTQFERHAGI
QRLVRDLNHLYQAQTALHQLDCDPRGFEWRLQDNADLSVIAHERMDEAGNRVLVITNFTP
VPQQEFRLGVPKTGKYRLLLNTDAKQYNGSDYPVLQDVSTEAISSEGLDQSLLLSVPPLA
TLFYQWSAK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcacaaaaaaaccatccaaggttcaacaattttatgatcagttggcgcgtgca
gcctttgctgatcccttttcatttctaggcccttacattcccgctgaacaaggtgcgctg
cgagtgtggatgccgggtgctgacaacgtcgcgttggtggttgaagggcaagctcgtgtg
gcgttagagcgtgaaggcgagggcggctttgtgctgaaagatggccgtaatctgcgtttt
acgcactaccaattggctgtcgattgggcgggtaccgagcagttactcgatgatccgtat
caatatcacggcctctacgctgaatatgaagatctgcatacgccaaagcagatgtatcac
catatgggggcgcagtttgtcaccctagagcgtgatggaaaaatggtctctggcgtacgt
tttctggtgtatgcccctcacgcggcggcgtgcagtttgattggcgcgtttaaccattgg
gatggtcgtcgccatccgatgcagcgtctcgattacggtatttggggaatttttatcccc
ggcttgccggaaggcacgcaatacaaatttgagctgaaaggcccacatggagaaggtctg
ccgcataaagcggatccgtggggtttttatgctgagcaatacccttcttttgcttctgtg
acttatgatcatcgtcgttatcagtggcaagatacggcttggcagcagcgccctgtgact
gaaaagcgtaaacaagcgctctcgttttatgagctgcacgttggctcatggaagcgaggc
gaaaacggtgaattcctcaattatcgtgaattggctgatcaattggtgccttatctggtt
gagatgggttatacccatgttgagttaatgcctgtcgctgagcacccattttatggttct
tggggctatcaaccggttggtctgtttgcgcccactagccgttacggctcgccggatgat
ttcaaatattttgttgatttgtgccaccaagcggggattggtgtggtgctcgattgggtg
cctgcgcacttcccatcagattctcacggtctggccaattttgatggcacgcccttattc
catgatccggatccacgtcgcggttggcatcaagactggaactcttacatctacgatctt
ggtcgcgagcatgtgcgccgtttcttagtcgctaatgcgctgtattggtttgagatgttc
catatcgatggcattcgtgttgatgcggtcgcatcgatgctctatctcgattattcgcgt
agccatgatcaatggatcccgaatgttgacggtggacgcgaaaactacgatgcgattgct
accttcaaatggatgaacgaggaggtatacaaacacttcccgaatgcgatgacgattgcc
gaagaatcgacggctttccccggtgtttctgccccgacctttatgggcggcctcgggttt
ggttttaagtggaacatgggctggatgcacgatagcttgtcgtacatcaaagaggatccg
gtgcatcgcaaataccaccacaataccctgactttcccgctgatttacgcgtttagtgaa
aactatgtgctctctttatcacacgatgaagtggtgtatggtaagcgctcacttatgtac
aaaatgccgggtgatgagtggcagcaaaccgccaacttacgcgcctacttgggttatatg
tatggtcagccgggcaaaaaactcaactttatgggtaccgaattaggacagactgcggag
tgggatcacgatggtcagttgcagtggttcttaacgcaatttgagcgccatgccgggatc
cagcgtttggtgcgcgatttgaaccatctgtaccaagcccaaacggcgttgcatcagctt
gattgcgatccgcgcggcttcgaatggcgcttacaagataatgccgatctcagcgtgatc
gctcatgaacggatggatgaagccggtaatcgtgtgttagtgatcaccaacttcacgcct
gttccacagcaggaatttcgcttaggcgttcctaaaacagggaagtaccgcttgttgctc
aataccgatgccaagcagtacaacggcagtgattatccggtattgcaggatgtgagtacg
gaagcgatcagcagtgaaggtttggatcaatcgctgctattgagtgtgccgccgctcgcg
acgctattttatcaatggagtgcgaagtag

DBGET integrated database retrieval system