KEGG   Vibrio cholerae IEC224: O3Y_14088Help
Entry
O3Y_14088         CDS       T01766                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vci  Vibrio cholerae IEC224
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    O3Y_14088
Enzymes [BR:vci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     O3Y_14088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:145697..146617
Genome map
AA seq 306 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARMQADVGFIAC
VGDDSFGINIRESFKLDGINTAGVKLQPNCPTGIAMIQVSDSGENSICISAEANAKLTAA
AIEPDLAAIRDARYLLMQLETPLDGILKAAQEAKTAKTNVILNPAPARELPDELLKCVDL
ITPNETEAEVLTGITVYDDSSAQQAADALHCKGIEIVIITLGSKGVWLSQNGRGQRIPGF
VVKATDTTAAGDTFNGALVTGLLQEMPLESAIKFAHAAAAISVTRFGAQTSIPTRAEVEA
FLAEHS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttggtggttctgggtagcgtcaatgcagaccatgtgctgcaagtgccttca
tttcctcgccccggagaaaccctacacgggcgcaattatcaagtcattccgggcggaaaa
ggggcaaaccaagcggttgccgccgcgcgtatgcaagcggatgtaggtttcattgcctgt
gttggcgatgattcgtttggcattaatattcgtgaaagttttaagctagatggcattaat
acggcgggcgtgaagctgcaaccgaattgtccaactggtattgcgatgattcaagtttca
gacagtggtgagaacagtatctgtatttctgcagaagccaatgccaagctgacggccgct
gcgattgagcccgatcttgcggcgattcgggatgcacgttatttgctgatgcaactggaa
acaccgcttgatggcattttaaaagcagcgcaagaagccaaaacggccaaaaccaatgtg
attcttaaccctgcaccagcccgtgaactgcctgatgagttgctgaagtgtgtagatctg
attacgccgaacgaaaccgaagcggaagtgctcaccggaattacggtttatgatgattct
agcgcgcagcaagcggcggacgctttacactgtaaaggcatcgagattgtgattattacc
cttggttcaaagggtgtgtggctgagccaaaatggtcgcgggcaacgaattcccggtttt
gtggtgaaagccacggacaccaccgccgcaggtgatacctttaacggtgcattggtgact
ggcttgttgcaagaaatgcctctagaatcagccattaagtttgcccatgccgctgccgca
atttcggtaacacgctttggtgcacaaacctcgattcccactcgtgcggaagttgaggcc
tttttagcagaacactcatag

DBGET integrated database retrieval system