KEGG   Vibrio cholerae IEC224: O3Y_17018Help
Entry
O3Y_17018         CDS       T01766                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vci  Vibrio cholerae IEC224
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vci00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(687917..689434)
Genome map
AA seq 505 aa AA seqDB search
MTEQKYVVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKAGIRSDEVAAIGITNQRETTVVWNKETGKPVYNAIVWQCRRTAAICEELKERG
LESYIRDNTGLVLDPYFSGTKIKWILDNVEGAREQAEAGQLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINTLQWDEKILAEFNIPLSMMPEVKKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALYGQMCVQAGQAKNTYGTGCFLLMNTGQEKVTSHNGLLTTLACGPRGEPA
YALEGAVFMGGASIQWLRDELKLISDARDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQADVLDTEVHRPKVTEVTALGAAYLAGLAVGFWDGLEELQGKAEIDRSFKPHHDEEKR
QRRYKGWKRAVKCAQAWAVLHNEEE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacgtcgtcgctctcgatcaaggtactaccagctctcgcgccgtg
gtgttagaccatgatgcgaatatcgtgagcgtttctcagcgtgagtttacccaaatctac
ccacaagccgggtgggtggaacacgatccaatggaaatctacgctacgcaaagctcaaca
ttggttgaagcgctaggtaaagcgggcattcgcagtgatgaagttgcggccatcggtatt
accaaccaacgtgaaaccacggtggtgtggaataaagagacgggtaagcctgtctacaat
gcgattgtttggcaatgtcgccgtactgctgccatttgtgaagagctgaaagagcgcggt
ttagaaagttacattcgtgacaataccggtttggtgctcgacccttacttctcaggtacc
aaaattaaatggattctggacaatgtagaaggcgcacgcgagcaagctgaagcaggacaa
ctgctgtttggtacggttgatacatggctagtgtggaaaatgacacaaggccgtgtgcat
gtgaccgattacaccaacgcatcccgtactatgctgttcaacatcaacaccttgcagtgg
gatgaaaagatcctcgccgaatttaatatcccgctctccatgatgccggaagtgaaaaaa
tcgtctgaagtgtacggtcaaaccaacatcggtggtaaaggcggtacgcgtattccaatc
gcggggattgccggtgaccaacaagcggcgctgtacggccaaatgtgtgtgcaagcggga
caagcgaaaaacacctacggtacgggttgcttcttgctgatgaacacgggacaggaaaaa
gtgacctcgcacaacggcttgctgaccacgctagcgtgtggcccacgcggtgaaccagct
tatgcactggaaggggcggtgtttatgggcggtgcatccattcaatggctgcgtgatgag
ctgaaactgatttccgatgctcgcgactcagagtacttcgccaccaaagtggatacctcc
aatggggtgtatgtggtgccagcctttacgggtttaggcgctccgtactgggatgcgtat
gcgcgtggcacaattgtcggcttaacccgtggtgtgaactcaaaccacattattcgcgca
acgctggaaagtatcgcttaccaaacgcgtgatgtgttggatgcgatgcaagccgattct
ggcatcaagctttctgcgctgcgtgtcgatggtggtgcggtcgccaacaacttcctgatg
cagttccaagcagatgtattggataccgaagtgcatcgtccgaaagtcacggaagtcacc
gcgttaggcgccgcttacctcgccggtctggccgttggtttctgggatggtttggaagag
ctgcaaggcaaagcggaaatcgatcgcagctttaaaccgcatcatgatgaagagaagcgt
caacgccgttataaaggttggaagcgtgcggtgaaatgtgcccaagcgtgggcagtactg
cacaacgaagaagagtaa

DBGET integrated database retrieval system