KEGG   Vibrio cholerae IEC224: O3Y_17188Help
Entry
O3Y_17188         CDS       T01766                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vci  Vibrio cholerae IEC224
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    O3Y_17188
Enzymes [BR:vci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     O3Y_17188
   3.1.2  Thioester hydrolases
    3.1.2.-  
     O3Y_17188
Lipid biosynthesis proteins [BR:vci01004]
 Fatty acid synthase
  Component type
   O3Y_17188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:726713..727312
Genome map
AA seq 199 aa AA seqDB search
MTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSLLAEELVEQGQTVTVVN
GSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQTVTHNLTTMIEQIQAKN
AKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQVILKPEWMMADGLHPK
PEAQPWIAKFVAEHLAAHL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgactcgactactttcctttttgtttgttgttctcttttctgctgcagccagcagtaaa
acgttattggtactcggcgacagtttaagcgcagggtacgaaatgcctatcgaacaagct
tggccaagtttactggccgaagagctagtggaacagggtcaaaccgttaccgtagttaac
ggaagcatttctggtgataccacaggcaacgggctcgcccgcctgccctctcttctgagc
caacatcagcccgataccgtactgatagaattaggagccaacgacggtttacgcggtttt
ccaccgcaaacggtcactcataacctcaccaccatgattgaacagatccaagctaaaaac
gcaaaagtcatcttaatgcagatccgtatcccacctaactatggcaaacggtacagcgat
gcgttttaccagatctatcctagcctagctgagcagttttctatcccgcttatcccgttc
tttcttgagcaagtgatcctcaaaccagaatggatgatggcagatggtttacaccccaaa
cctgaagcgcagccttggatagccaagtttgtggccgaacaccttgccgcacatttgtaa

DBGET integrated database retrieval system