KEGG   Vibrio cholerae IEC224: O3Y_17973Help
Entry
O3Y_17973         CDS       T01766                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vci  Vibrio cholerae IEC224
Brite
Enzymes [BR:vci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     O3Y_17973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
II:904649..905665
Genome map
AA seq 338 aa AA seqDB search
MTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGLC
PPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKDL
ERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDAL
FDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKRL
QSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSITA
SFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtacctttaatg
atgaaacatcatgtcgcggccacccccgtgaactatgccttgtggtatacctacgtcgac
caagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctttgc
ccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaaccaat
attaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatgagt
gatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggattta
gagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgcttg
gtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaacgcg
gcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgctctg
tttgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacgctg
atccatgcaggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagccctt
aatgataactatggccacctgtttggtgaccaaattatccgtgcgatcgccaaacgtctt
caaagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgcactg
attgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgttca
atagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattaccgct
tcgtttggtgtagtagaaaagattgaaggtgactctttggagtctcttatcggtcgagcg
gatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system