KEGG   Vibrio cholerae IEC224: O3Y_17973Help
Entry
O3Y_17973         CDS       T01766                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
vci  Vibrio cholerae IEC224
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:904649..905665
Genome map
AA seq 338 aa AA seqDB search
MTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGLC
PPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKDL
ERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDAL
FDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKRL
QSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSITA
SFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtacctttaatg
atgaaacatcatgtcgcggccacccccgtgaactatgccttgtggtatacctacgtcgac
caagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctttgc
ccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaaccaat
attaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatgagt
gatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggattta
gagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgcttg
gtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaacgcg
gcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgctctg
tttgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacgctg
atccatgcaggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagccctt
aatgataactatggccacctgtttggtgaccaaattatccgtgcgatcgccaaacgtctt
caaagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgcactg
attgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgttca
atagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattaccgct
tcgtttggtgtagtagaaaagattgaaggtgactctttggagtctcttatcggtcgagcg
gatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system