KEGG   Vibrio cholerae MJ-1236: VCD_000217Help
Entry
VCD_000217        CDS       T00903                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCD_000217
Enzymes [BR:vcj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VCD_000217
Exosome [BR:vcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCD_000217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(254135..256276)
Genome map
AA seq 713 aa AA seqDB search
MARAAFADPFSFLGPYIPAEQGALRVWMPGADNVALVVEGQARVALEREGEGGFVLKDGR
NLRFTHYQLAVDWAGTEQLLDDPYQYHGLYAEYEDLHTPKQMYHHMGAQFVTLERDGKMV
SGVRFLVYAPHAAACSLIGAFNHWDGRRHPMQRLDYGIWGIFIPGLPEGTQYKFELKGPH
GEGLPHKADPWGFYAEQYPSFASVTYDHRRYQWQDTAWQQRPVTEKRKQALSFYELHVGS
WKRGENGEFLNYRELADQLVPYLVEMGYTHVELMPVAEHPFYGSWGYQPVGLFAPTSRYG
SPDDFKYFVDLCHQAGIGVVLDWVPAHFPSDSHGLANFDGTPLFHDPDPRRGWHQDWNSY
IYDLGREHVRRFLVANALYWFEMFHIDGIRVDAVASMLYLDYSRSHDQWIPNVDGGRENY
DAIATFKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYI
KEDPVHRKYHHNTLTFPLIYAFSENYVLSLSHDEVVYGKRSLMYKMPGDEWQQTANLRAY
LGYMYGQPGKKLNFMGTELGQTAEWDHDGQLQWFLTQFERHAGIQRLVRDLNHLYQAQTA
LHQLDCDPRGFEWRLQDNADLSVIAHERMDEAGNRVLVITNFTPVPQQEFRLGVPKTGKY
RLLLNTDAKQYNGSDYPVLQDVSTEAISSEGLDQSLLLSVPPLATLFYQWSAK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcgtgcagcctttgctgatcccttttcatttctaggcccttacattcccgctgaa
caaggtgcgctgcgagtgtggatgccgggtgctgacaacgtcgcgttggtggttgaaggg
caagctcgtgtggcgttagagcgtgaaggcgagggcggctttgtgctgaaagatggccgt
aatctgcgttttacgcactaccaattggctgtcgattgggcgggtaccgagcagttactc
gatgatccgtatcaatatcacggcctctacgctgaatatgaagatctgcatacgccaaag
cagatgtatcaccatatgggggcgcagtttgtcaccctagagcgtgatggaaaaatggtc
tctggcgtacgttttctggtgtatgcccctcacgcggcggcgtgcagtttgattggcgcg
tttaaccattgggatggtcgtcgccatccgatgcagcgtctcgattacggtatttgggga
atttttatccccggcttgccggaaggcacgcaatacaaatttgagctgaaaggcccacat
ggagaaggtctgccgcataaagcggatccgtggggtttttatgctgagcaatacccttct
tttgcttctgtgacttatgatcatcgtcgttatcagtggcaagatacggcttggcagcag
cgccctgtgactgaaaagcgtaaacaagcgctctcgttttatgagctgcacgttggctca
tggaagcgaggcgaaaacggtgaattcctcaattatcgtgaattggctgatcaattggtg
ccttatctggttgagatgggttatacccatgttgagttaatgcctgtcgctgagcaccca
ttttatggttcttggggctatcaaccggttggtctgtttgcgcccactagccgttacggc
tcgccggatgatttcaaatattttgttgatttgtgccaccaagcggggattggtgtggtg
ctcgattgggtgcctgcgcacttcccatcagattctcacggtctggccaattttgatggc
acgcccttattccatgatccggatccacgtcgcggttggcatcaagactggaactcttac
atctacgatcttggtcgcgagcatgtgcgccgtttcttagtcgctaatgcgctgtattgg
tttgagatgttccatatcgatggcattcgtgttgatgcggtcgcatcgatgctctatctc
gattattcgcgtagccatgatcaatggatcccgaatgttgacggtggacgcgaaaactac
gatgcgattgctaccttcaaatggatgaacgaggaggtatacaaacacttcccgaatgcg
atgacgattgccgaagaatcgacggctttccccggtgtttctgccccgacctttatgggc
ggcctcgggtttggttttaagtggaacatgggctggatgcacgatagcttgtcgtacatc
aaagaggatccggtgcatcgcaaataccaccacaataccctgactttcccgctgatttac
gcgtttagtgaaaactatgtgctctctttatcacacgatgaagtggtgtatggtaagcgc
tcacttatgtacaaaatgccgggtgatgagtggcagcaaaccgccaacttacgcgcctac
ttgggttatatgtatggtcagccgggcaaaaaactcaactttatgggtaccgaattagga
cagactgcggagtgggatcacgatggtcagttgcagtggttcttaacgcaatttgagcgc
catgccgggatccagcgtttggtgcgcgatttgaaccatctgtaccaagcccaaacggcg
ttgcatcagcttgattgcgatccgcgcggcttcgaatggcgcttacaagataatgccgat
ctcagcgtgatcgctcatgaacggatggatgaagccggtaatcgtgtgttagtgatcacc
aacttcacgcctgttccacagcaggaatttcgcttaggcgttcctaaaacagggaagtac
cgcttgttgctcaataccgatgccaagcagtacaacggcagtgattatccggtattgcag
gatgtgagtacggaagcgatcagcagtgaaggtttggatcaatcgctgctattgagtgtg
ccgccgctcgcgacgctattttatcaatggagtgcgaagtag

DBGET integrated database retrieval system