KEGG   Vibrio cholerae MJ-1236: VCD_000378Help
Entry
VCD_000378        CDS       T00903                                 

Definition
GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
vcj  Vibrio cholerae MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(439996..441015)
Genome map
AA seq 339 aa AA seqDB search
MMTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGL
CPPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKD
LERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDA
LFDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKR
LQSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSIT
ASFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtaccttta
atgatgaaacatcatgtcgcggccacccccgtgaactatgccttgtggtatacctacgtc
gaccaagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctt
tgcccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaacc
aatattaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatg
agtgatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggat
ttagagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgc
ttggtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaac
gcggcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgct
ctgtttgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacg
ctgatccatgcaggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagcc
cttaatgataactatggccacctgtttggtgaccaaattatccgtgcgatcgccaaacgt
cttcaaagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgca
ctgattgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgt
tcaatagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattacc
gcttcgtttggtgtagtagaaaagattgaaggtgactctttggagtctcttatcggtcga
gcggatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system