KEGG   Vibrio cholerae MJ-1236: VCD_000510Help
Entry
VCD_000510        CDS       T00903                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VCD_000510
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VCD_000510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:584482..585411
Genome map
AA seq 309 aa AA seqDB search
MNDLFTKTDYSLYSNAMTFVRRPYVRNPVDTNADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNLFKKINVIDAGDLVFDCGDAEDFTYRLEAATSEILKSGKTML
ALGGDHFITLPILRAYAKHFGEMALIHFDAHTDTYANGSAYDHGTMFYHAPKEGLISAKH
SVQVGIRTEYKQEGHGFNVINAMQANDMSVEEIVAQIRHIVGDKPVYLTFDIDCLDPAFA
PGTGTPVCGGLSSDKILKIIRALKGINLIGMDVVEVSPPYDQSDLTSLAGATIALELLYV
WASNKKDEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaactgattattcactctactcaaacgcgatgacgtttgtc
cgtcgtccctatgtgcgtaacccagtagatactaatgctgatgtcgtggtacttggcgtg
cctttggatatggcgacgtccggtcgtccgggggctcgtatggggcctgacgcgattcgt
cgtgcttcggttaacctcgcttgggaaggtaagaaattcccttgggatttcaacctgttt
aaaaagatcaacgtgattgatgcgggcgatttggtttttgattgcggtgatgctgaagat
ttcacttaccgcctagaagccgcgaccagcgaaatcctgaaaagtggcaaaaccatgctg
gcactgggtggcgatcacttcatcactctgccaatcctgcgtgcttacgctaagcacttc
ggtgaaatggcgctgatccactttgatgcacacacggacacttacgcgaacggcagtgcg
tatgaccacggcaccatgttctaccatgcgccaaaagaaggtctgatctcggctaagcat
tcggtgcaagtgggtattcgtacggaatacaaacaagaaggccacggcttcaacgtgatt
aacgcgatgcaagccaacgacatgtctgtcgaagagattgtggcgcaaattcgccacatc
gtgggtgacaagccggtttacctgactttcgacattgactgtctggatcctgctttcgca
ccgggtacgggtacgccagtttgtggcggtttgagctcagacaagatcctgaaaatcatc
cgcgcgctgaaaggcatcaacctgatcggtatggatgtggtagaagtgtcacctccttac
gatcaaagcgacctgacttcactggcgggtgcgacgatcgctctggaactgctctacgtt
tgggcatccaacaagaaagatgaagagtaa

DBGET integrated database retrieval system