KEGG   Vibrio cholerae MJ-1236: VCD_000539Help
Entry
VCD_000539        CDS       T00903                                 

Definition
arylesterase precursor (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VCD_000539
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VCD_000539
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VCD_000539
Lipid biosynthesis proteins [BR:vcj01004]
 Fatty acid synthase
  Component type
   VCD_000539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(618345..618959)
Genome map
AA seq 204 aa AA seqDB search
MMDVCMTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSLLAEELVEQGQT
VTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQTVTHNLTTMIEQ
IQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQVILKPEWMMAD
GLHPKPEAQPWIAKFVAEHLAAHL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgtttgcatgactcgactactttcctttttgtttgttgttctcttttctgct
gcagccagcagtaaaacgttattggtactcggcgacagtttaagcgcagggtacgaaatg
cctatcgaacaagcttggccaagtttactggccgaagagctagtggaacagggtcaaacc
gttaccgtagttaacggaagcatttctggtgataccacaggcaacgggctcgcccgcctg
ccctctcttctgagccaacatcagcccgataccgtactgatagaattaggagccaacgac
ggtttacgcggttttccaccgcaaacggtcactcataacctcaccaccatgattgaacag
atccaagctaaaaacgcaaaagtcatcttaatgcagatccgtatcccacctaactatggc
aaacggtacagcgatgcgttttaccagatctatcctagcctagctgagcagttttctatc
ccgcttatcccgttctttcttgagcaagtgatcctcaaaccagaatggatgatggcagat
ggtttacaccccaaacctgaagcgcagccttggatagccaagtttgtggccgaacacctt
gccgcacatttgtaa

DBGET integrated database retrieval system