KEGG   Vibrio cholerae MJ-1236: VCD_000607Help
Entry
VCD_000607        CDS       T00903                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VCD_000607
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     VCD_000607
    3.5.1.-  
     VCD_000607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:687782..688402
Genome map
AA seq 206 aa AA seqDB search
MSKALLLVDVQNDFSPSGALPVPDGDAVVPVINQLLPLFEHVIATKDWHPAKHASFASVQ
GKTPGEVIDLNGIPQVMWPDHCVQNTHGAEFIAGLDVQRITHIVTKGTHLDVDSYSGFFD
NQRFHATGLAEYLSNQGISEVYIAGLATDYCVKYTALDAVSLYFKTWVIQDACRGVELNA
GDCATAWHAMQTAGCQLITSQQLLAG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcacttctgttagttgatgtccaaaatgatttttcacccagcggtgcgctg
cctgtgccggatggcgatgcggtcgtccctgtgattaatcaattgcttccgctctttgaa
catgtgattgccaccaaagattggcacccagccaaacacgcgagttttgcgtccgtgcag
gggaaaactccgggcgaagtcattgaccttaatggcattccacaagtgatgtggcctgat
cactgcgtgcaaaatacccatggtgcagaatttatagctgggttagatgtgcagcgaatt
acgcacattgtcaccaaaggcacccatcttgatgtggacagctacagtggtttttttgat
aaccaacgtttccatgctaccggattggccgaatacttgagtaatcagggaatttcagag
gtttacattgcaggtttggcgaccgactactgtgtgaaatataccgcgctggatgcagtt
tccctctactttaaaacttgggtcattcaggatgcgtgtcgaggtgtggaactgaatgcg
ggcgattgcgcgacagcgtggcacgcgatgcaaacggcagggtgtcagttgatcacttct
cagcagttgcttgccggttaa

DBGET integrated database retrieval system