KEGG   Vibrio cholerae MJ-1236: VCD_000750Help
Entry
VCD_000750        CDS       T00903                                 

Definition
enterotoxin A subunit (NAD(+)--diphthamide ADP-ribosyltransferase) (EC:2.4.2.36)
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Vibrio cholerae infection
Vibrio cholerae pathogenic cycle
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    VCD_000750
   05111 Vibrio cholerae pathogenic cycle
    VCD_000750
Enzymes [BR:vcj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     VCD_000750
Bacterial toxins [BR:vcj02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    VCD_000750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2:complement(852604..853380)
Genome map
AA seq 258 aa AA seqDB search
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLY
DHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLG
AYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGY
GLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQI
FSGYQSDIDTHNRIKDEL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagataatatttgtgttttttattttcttatcatcattttcatatgcaaatgat
gataagttatatcgggcagattctagacctcctgatgaaataaagcagtcaggtggtctt
atgccaagaggacagagtgagtactttgaccgaggtactcaaatgaatatcaacctttat
gatcatgcaagaggaactcagacgggatttgttaggcacgatgatggatatgtttccacc
tcaattagtttgagaagtgcccacttagtgggtcaaactatattgtctggtcattctact
tattatatatatgttatagccactgcacccaacatgtttaacgttaatgatgtattaggg
gcatacagtcctcatccagatgaacaagaagtttctgctttaggtgggattccatactcc
caaatatatggatggtatcgagttcattttggggtgcttgatgaacaattacatcgtaat
aggggctacagagatagatattacagtaacttagatattgctccagcagcagatggttat
ggattggcaggtttccctccggagcatagagcttggagggaagagccgtggattcatcat
gcaccgccgggttgtgggaatgctccaagatcatcgatgagtaatacttgcgatgaaaaa
acccaaagtctaggtgtaaaattccttgacgaataccaatctaaagttaaaagacaaata
ttttcaggctatcaatctgatattgatacacataatagaattaaggatgaattatga

DBGET integrated database retrieval system