KEGG   Vibrio cholerae MJ-1236: VCD_001228Help
Entry
VCD_001228        CDS       T00903                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:vcj00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vcj00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vcj00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vcj00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:218558..219433
Genome map
AA seq 291 aa AA seqDB search
MMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGK
HSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELV
GDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKD
DLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKA
GCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgattaagaagtgtctatttccggcagctggctacggtacccgattcctaccagcg
actaagtcgatgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggt
gttgatgaagcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaag
cattcgatcatggatcactttgacatgaactacgagttagagcaccaaatccgcggtacg
aataaagaagagctattgggtgatatccgtaaaatcatcgaaagcgctaactttactttt
attcgccaacgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtc
ggtgatgagccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggc
gtactggcacagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaa
gaggttccagaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagac
gatctgttccgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaac
ctcgccatcattggccgttatatcctcacgccagatatttttgatctgattgagcagacc
gagccgggcaaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcg
ggttgtgtactggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggc
tatatcgaagccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtg
gagttggctaaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system