KEGG   Vibrio cholerae MJ-1236: VCD_001228Help
Entry
VCD_001228        CDS       T00903                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
vcj00040  Pentose and glucuronate interconversions
vcj00052  Galactose metabolism
vcj00500  Starch and sucrose metabolism
vcj00520  Amino sugar and nucleotide sugar metabolism
vcj01100  Metabolic pathways
vcj01130  Biosynthesis of antibiotics
Module
vcj_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VCD_001228
   00052 Galactose metabolism
    VCD_001228
   00500 Starch and sucrose metabolism
    VCD_001228
   00520 Amino sugar and nucleotide sugar metabolism
    VCD_001228
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VCD_001228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Smr
Motif
Other DBs
NCBI-ProteinID: ACQ59401
Position
1:218558..219433
Genome map
AA seq 291 aa AA seqDB search
MMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGK
HSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELV
GDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKD
DLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKA
GCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgattaagaagtgtctatttccggcagctggctacggtacccgattcctaccagcg
actaagtcgatgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggt
gttgatgaagcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaag
cattcgatcatggatcactttgacatgaactacgagttagagcaccaaatccgcggtacg
aataaagaagagctattgggtgatatccgtaaaatcatcgaaagcgctaactttactttt
attcgccaacgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtc
ggtgatgagccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggc
gtactggcacagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaa
gaggttccagaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagac
gatctgttccgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaac
ctcgccatcattggccgttatatcctcacgccagatatttttgatctgattgagcagacc
gagccgggcaaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcg
ggttgtgtactggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggc
tatatcgaagccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtg
gagttggctaaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system