KEGG   Vibrio cholerae MJ-1236: VCD_001257Help
Entry
VCD_001257        CDS       T00903                                 

Definition
primosomal replication protein N
Orthology
K02686  
primosomal replication protein N
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vcj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(255369..255686)
Genome map
AA seq 105 aa AA seqDB search
MSNGLMTNRIELSGVVAKALVRSQSPSGVKHCHFWLEHRSTMVEADLPRQVFCRLPVVVS
GARSEALTQNLVQGSSILVSGFLAYQTSRNGVGKLVLHADKISQI
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaatggtttgatgaccaatcgaatcgagttgagcggcgttgtcgcaaaggctctg
gttcgaagccaaagtccatcgggtgttaaacattgccatttttggctagagcatcgctct
acgatggtagaagctgacctcccaagacaagttttttgtcgattacctgtggtggtgagt
ggggctaggtcagaagcgttaactcaaaacttagtacaaggcagtagcattttggtaagt
ggttttttggcttaccaaaccagccgaaatggcgtaggtaaattagtgctgcatgccgac
aaaatttctcaaatatag

DBGET integrated database retrieval system