KEGG   Vibrio cholerae MJ-1236: VCD_001556Help
Entry
VCD_001556        CDS       T00903                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vcj  Vibrio cholerae MJ-1236
Brite
Enzymes [BR:vcj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VCD_001556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:597112..597906
Genome map
AA seq 264 aa AA seqDB search
MSMGGSDNLKTSIGHNWQQGPINSPTVLNSSLNIAQFWDGRAADLKEQAGGPIANPGEMA
FTHTLAIDVLQSIPAYVSEFRLVFGKPTLDIDQVTEAIAEFEKTLVTPYSRFDQWLMGDD
SAITAQELAGYELFKNSGCVACHNGSALGGNSFQKMGLIEPYQTNNKVEGLSAVTGADAD
RFKFKVPTLRNVALTYPYFHDGEAATLKDAVDIMGRLQLGRKFTDDENGKIVAFLHTLTG
EQPSFALPILPPSNDNTPKPQPFD
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgggcggcagtgataacttaaaaacgtccatcggtcataactggcaacaaggt
ccaatcaactcaccgactgtgctcaattccagtttgaatatcgcccaattttgggatggt
cgagcggccgatctgaaagagcaggcgggtgggccgattgccaatccgggtgaaatggct
tttacgcatacgttagccattgatgtgttgcaatcaatcccagcttacgtgagtgagttt
cgtctagtgtttggtaagccaaccctcgatatcgatcaagtgactgaagcgattgcggag
tttgaaaagaccttagtgaccccatactcacgttttgaccaatggttaatgggggatgat
agcgcgataacggctcaagagctggcaggctatgaattgtttaaaaactcgggctgcgtg
gcttgtcataacggcagtgcgttaggtggcaattcgttccaaaaaatgggtttgattgaa
ccgtatcaaaccaacaataaagtcgaaggactcagtgcggtaaccggcgctgacgccgat
cgctttaaatttaaagtcccgacactgcgcaatgtggcgttaacgtatccctacttccat
gacggagaagcggccacgcttaaagacgctgtggatatcatggggcgtttacagctaggg
cgtaaatttaccgatgatgaaaacggtaagatagtggctttcttgcataccttaacagga
gagcaaccaagctttgctttacccattttaccgccatccaacgataatacacctaagcct
cagccttttgattag

DBGET integrated database retrieval system