KEGG   Vibrio cholerae MJ-1236: VCD_001679Help
Entry
VCD_001679        CDS       T00903                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:vcj01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vcj01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vcj00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:vcj00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vcj00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vcj00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:vcj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:736910..737878
Genome map
AA seq 322 aa AA seqDB search
MSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDRIKQLDRSSV
SDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMGAKKLTEMGF
PCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLT
LTSAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDANKLAKEIESA
TGRETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQKEQLVHHDII
DAIENMKRPVRTDLYKVAEELF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgattaaaaaaatcggtgttttgacgagtggtggcgatgccccaggtatgaat
gcagctattcgcggcgtggtgcgtacagcacttggcgcaggtttagaagtgtttggtatt
tacgacggctaccaaggtctgtacgaagatcgtattaagcagctagaccgttcaagcgtg
tctgacgtgatcaaccgtggcggtacttttttaggctctgcacgcttcccacaatttcgt
gaagttgaagtgcgcgaaaaagcgattgaaaacctgaaaaagcacggcattgaagcgctg
gttgtgattggtggtgacggctcttacatgggcgccaaaaaactgaccgaaatgggtttc
ccttgtatcggtctgccaggcacgattgataacgatatcgcgggcaccgactacaccatc
ggttatttgactgccctgaacaccgttattgaagcgattgaccgtctgcgcgatacctct
tcttcacaccaacgtatctctatcgtagaaatcatgggtcgtcactgtggtgacttgacg
ctgacctctgcgattgcgggtggctgtgaatacatcatcacaccggaaacgggtctgaat
atggagcagctgatttccaatatcaaagatggtattgcgaaaggcaaaaagcacgcgatc
attgcgctgactgagctgatgatggatgccaacaaactggccaaagagattgaatcggcg
acaggccgtgaaactcgcgcaactgtattaggccatattcaacgtggtggtaaacctacc
gcatttgaccgtgtactggcatcgcgcatgggtaactacgcggtgcatctattgatggaa
ggtcacggtggtcgttgtgtgggtatccagaaagagcaactggttcaccacgacatcatt
gatgcgattgaaaacatgaagcgtcctgtacgcactgacctgtacaaagtcgctgaagag
ctgttctaa

DBGET integrated database retrieval system