KEGG   Vibrio cholerae MJ-1236: VCD_001697Help
Entry
VCD_001697        CDS       T00903                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCD_001697 (tpiA)
   01230 Biosynthesis of amino acids
    VCD_001697 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCD_001697 (tpiA)
   00051 Fructose and mannose metabolism
    VCD_001697 (tpiA)
   00562 Inositol phosphate metabolism
    VCD_001697 (tpiA)
Enzymes [BR:vcj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VCD_001697 (tpiA)
Exosome [BR:vcj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VCD_001697 (tpiA)
  Exosomal proteins of bladder cancer cells
   VCD_001697 (tpiA)
  Exosomal proteins of melanoma cells
   VCD_001697 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(756635..757432)
Genome map
AA seq 265 aa AA seqDB search
MIRYGDIPMRRPVVMGNWKLNGSKAMVTDLLNGLNAELEGVEGVDVVVAPPAMYLDLAER
LIKEGGNKLILGAQNTDTHNSGAYTGDMSPAMLKDFGASHIIIGHSERRDYHKESDEFVA
KKFAFLKENGLTPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIW
AIGTGKAATADDAQRIHASIRALIAAKDAAVAEQVIIQYGGSVKPENAASYFAQPDIDGA
LVGGASLDAKGFAAIAKAAAEAKKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgattagatatggagatattcctatgcgtcgtcctgttgtgatgggtaactggaaactg
aatggcagcaaagctatggtcactgacctgctaaacggtttgaatgcagaacttgaaggt
gttgaaggtgttgatgttgtcgttgcgccaccagcaatgtatttggatctggctgagcgc
ctgatcaaagaaggcggcaacaagctgatcctgggtgcacaaaacaccgatactcacaac
agtggtgcgtacacaggtgatatgtctcctgcgatgctgaaagatttcggtgcttcgcac
atcatcatcggtcactctgagcgtcgtgattaccacaaagaatcagatgagttcgtcgct
aagaaatttgcgttcctgaaagaaaacggcctaacgccagtcttctgtatcggtgaaact
gaagcgcaaaacgaagcgggcgaaacagaagcggtatgtgctcgccaaatcaacgcagtg
atcgatgcttacggcgttgaagcactgaacggcgcgatcatcgcttacgaaccaatctgg
gcaatcggtacgggtaaagccgcgacagcagatgatgcacagcgtatccacgcgtcaatc
cgtgcactgatcgctgcgaaagatgctgcagtggctgagcaagtgatcatccagtacggc
ggttccgtaaaaccagaaaacgcagcgtcttactttgcacaaccagacatcgatggtgcg
ctggttggcggtgcatcactggatgcgaaaggctttgccgcgatcgccaaagccgcagca
gaagcgaaaaaagcgtaa

DBGET integrated database retrieval system