KEGG   Vibrio cholerae MJ-1236: VCD_001937Help
Entry
VCD_001937        CDS       T00903                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vcj  Vibrio cholerae MJ-1236
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1001298..1002059
Genome map
AA seq 253 aa AA seqDB search
MIFMSVLRRLTWLAFPLLSMAFNVQANTAPAQLNKAELEQRFAKLGLQVEEIKTSDINGL
LEVQTSGGVLFSSPDGEHFIAGTLYALDGNGGYVDVLAKRQAPLNAKKIAALQDSMIEFK
APNEKYAITVFTDITCGYCVRLHSQIKEYNDLGITVRYLAYPRQGPQGQVADQMAAIWCS
NDPKAAMHDAKVNRKTITADKDIAQCQKTIAQHYMLGHELGISGTPAIFLPNGEMVGGYL
PAPQLLQRLQATQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgattttcatgagcgtactgcgccgactaacatggctggcatttcctttactgagtatg
gcattcaacgtacaagcgaacactgcaccagcacaattgaataaagccgagcttgagcag
cgctttgccaaactcggattgcaagtggaagagataaaaacctctgatatcaatggcttg
cttgaagtgcaaacgtctggtggtgtgttgttctcttcgcctgatggtgagcactttatc
gcgggtactctgtatgcgctggatggtaatggcggttatgttgatgtgctggctaaacgc
caagcgccactcaacgccaagaaaattgccgcattgcaagacagcatgattgagtttaaa
gcgcccaatgagaaatacgcgatcaccgtatttaccgatatcacgtgtggttactgtgtg
cgtctgcacagccagatcaaagagtacaatgatctcggcattacggtgcgttatctcgcc
tacccgcgtcaggggccgcaaggtcaagtcgcggatcaaatggcggccatctggtgttct
aacgatccgaaagcggcgatgcacgatgcgaaagtgaatcgtaaaaccattaccgccgat
aaagatatcgcccaatgccaaaagaccatcgcgcagcactatatgctgggtcacgagctc
ggcattagcggtactccagcgattttcttacccaatggtgagatggttggcggctatttg
cctgcgccgcaattgctgcaacgcctgcaagccacacaatag

DBGET integrated database retrieval system