KEGG   Vibrio cholerae MJ-1236: VCD_001962Help
Entry
VCD_001962        CDS       T00903                                 

Definition
carbamoyl phosphate synthase small subunit (EC:6.3.5.5)
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vcj00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:vcj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1036231..1037370
Genome map
AA seq 379 aa AA seqDB search
MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHI
GNTGTNSEDEESTAIHAQGLVIRDLPLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTR
ILREKGAQNGCIMAGDNLDEALALAKAKEFPGLKGMDLAKVVSTKEAYAWKQGSWTLEGG
LPEAKADSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSAEDVLALNPDGVFLSN
GPGDPEPCTYAIEATRVFLEKNIPVFGICLGHQILALASGAKTVKMKFGHHGANHPVKDL
DRGVVMITSQNHGFAADEATLPDNLRATHKSLFDGSLQGIHRTDKPAFSFQGHPEASPGP
HDAAPLFDHFIELIKQFRA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaatcagcactgttagtcctagaagatgggacagtgttccgcggagtgtccatc
ggggcagatggtatttccgtcggtgaagtcgttttcaatacctcgatgacggggtaccaa
gaaatcctcactgatccttcttattcccagcaaatcgttactcttacttatcctcacatt
ggcaataccggaaccaactccgaagacgaagaatccaccgcgattcatgctcaaggcctt
gtgattcgcgatctccctcttatcgcttctaacttccgcagtgaacaatccctctctgat
tatctcaagtcacaaaacattgtcggtattgctgacattgatacccgtaaactgactcgt
atcttgcgtgagaaaggcgcacagaacggctgcatcatggcgggcgataatctggatgaa
gcattagcactggcgaaagcgaaagagtttccgggcctgaaaggcatggatctcgcgaaa
gtggtttccaccaaagaagcgtatgcgtggaaacaaggctcatggacgctagaaggcggc
ctacctgaagcgaaagcggacagcgagctgccttaccatgttgtggcttacgattttggt
gcgaagcgtaacatcctacgtatgttggtggatcgtggctgccgcttaactgtggtaccg
gcgcagacctctgcagaagacgtgctcgcccttaatccagacggtgtgtttctatccaat
ggcccaggcgacccagagccatgtacttatgcgattgaagccacacgcgttttccttgag
aaaaacattcctgtttttgggatctgtctaggtcaccaaattctggcactcgcctccggc
gcgaaaacagtaaaaatgaagttcggtcaccatggtgcaaaccatccagtgaaagatttg
gatcgcggtgtggtgatgatcacctcgcaaaaccacggttttgcagccgatgaagcgact
ctgcctgacaacctgcgtgcaacccacaaatcgctgtttgatggttcactgcaagggatt
catcgtaccgacaagccagcgtttagcttccaaggccacccagaagcaagcccaggtcca
cacgatgcagcaccgctgtttgaccactttattgaactgattaaacaattccgcgcttaa

DBGET integrated database retrieval system