KEGG   Vibrio cholerae MJ-1236: VCD_001962Help
Entry
VCD_001962        CDS       T00903                                 

Definition
carbamoyl phosphate synthase small subunit (EC:6.3.5.5)
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VCD_001962
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VCD_001962
Enzymes [BR:vcj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     VCD_001962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1036231..1037370
Genome map
AA seq 379 aa AA seqDB search
MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHI
GNTGTNSEDEESTAIHAQGLVIRDLPLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTR
ILREKGAQNGCIMAGDNLDEALALAKAKEFPGLKGMDLAKVVSTKEAYAWKQGSWTLEGG
LPEAKADSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSAEDVLALNPDGVFLSN
GPGDPEPCTYAIEATRVFLEKNIPVFGICLGHQILALASGAKTVKMKFGHHGANHPVKDL
DRGVVMITSQNHGFAADEATLPDNLRATHKSLFDGSLQGIHRTDKPAFSFQGHPEASPGP
HDAAPLFDHFIELIKQFRA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaatcagcactgttagtcctagaagatgggacagtgttccgcggagtgtccatc
ggggcagatggtatttccgtcggtgaagtcgttttcaatacctcgatgacggggtaccaa
gaaatcctcactgatccttcttattcccagcaaatcgttactcttacttatcctcacatt
ggcaataccggaaccaactccgaagacgaagaatccaccgcgattcatgctcaaggcctt
gtgattcgcgatctccctcttatcgcttctaacttccgcagtgaacaatccctctctgat
tatctcaagtcacaaaacattgtcggtattgctgacattgatacccgtaaactgactcgt
atcttgcgtgagaaaggcgcacagaacggctgcatcatggcgggcgataatctggatgaa
gcattagcactggcgaaagcgaaagagtttccgggcctgaaaggcatggatctcgcgaaa
gtggtttccaccaaagaagcgtatgcgtggaaacaaggctcatggacgctagaaggcggc
ctacctgaagcgaaagcggacagcgagctgccttaccatgttgtggcttacgattttggt
gcgaagcgtaacatcctacgtatgttggtggatcgtggctgccgcttaactgtggtaccg
gcgcagacctctgcagaagacgtgctcgcccttaatccagacggtgtgtttctatccaat
ggcccaggcgacccagagccatgtacttatgcgattgaagccacacgcgttttccttgag
aaaaacattcctgtttttgggatctgtctaggtcaccaaattctggcactcgcctccggc
gcgaaaacagtaaaaatgaagttcggtcaccatggtgcaaaccatccagtgaaagatttg
gatcgcggtgtggtgatgatcacctcgcaaaaccacggttttgcagccgatgaagcgact
ctgcctgacaacctgcgtgcaacccacaaatcgctgtttgatggttcactgcaagggatt
catcgtaccgacaagccagcgtttagcttccaaggccacccagaagcaagcccaggtcca
cacgatgcagcaccgctgtttgaccactttattgaactgattaaacaattccgcgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system