KEGG   Vibrio cholerae MJ-1236: VCD_001987Help
Entry
VCD_001987        CDS       T00903                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
vcj00260  Glycine, serine and threonine metabolism
vcj00750  Vitamin B6 metabolism
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01120  Microbial metabolism in diverse environments
vcj01230  Biosynthesis of amino acids
Module
vcj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VCD_001987
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VCD_001987
Enzymes [BR:vcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VCD_001987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACQ60156
Position
1:1075789..1077069
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLLFPAQLPKFDDIDALLAEDFVSRSSKILSAL
IGDELPADKIRAMVDSAFQFAAPIAKVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
NGGKITILTATSGDTGAAVAHAFYGMPDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELRQQIGLNSANSINISRLMAQICYYFEAAAQMSKAERENLV
ISVPSGNFGNLTAGLLAKALGLPVKRFIAATNANDTVPRYLETGRWEPKPTVATTSNAMD
VSQPNNWPRIEELCQRMGWGLETLGKGAVSDEESAQAVQELYDLGYLCEPHGSIAYRVLE
EQRQPQETGLFLCTAHPAKFKEVVDDILGTDIALPAPLAKHAAMELLSQELNADFAALRA
LLVNVK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacaacataaaagaaaatgatgaacaagtctcctttggtcaagccgttcgc
caagggttaggccgcaatcaaggcctgctttttccggcacaattgccgaagtttgacgat
attgatgctctattggccgaagatttcgtctctcgtagcagcaagattttatcggcgttg
attggcgatgaactgcctgcggataaaattcgcgctatggtggattccgcctttcaattc
gccgcaccgattgccaaagtgaaagagggcgtttacgcgctcgaattgttccacgggcca
acgctcgcgtttaaagattttggtggtcgctttatggcccagtctctggcggcggtctcg
aacggcggaaaaatcacgattttgacggcgacatccggtgataccggcgctgctgttgcg
cacgcattttatggtatgccagacattaatgtggtgatcctttatccgaaaggaaaaatc
agtccgctgcaagaaaagctgttctgcacattaggtaaaaacattcacaccgtggcgatc
aatggcgattttgatgcttgccaagcactagtgaaacaagcttttgatgacgcagagctg
cgccaacagataggtttgaactctgccaactcaattaacatcagccgtttgatggcacaa
atctgttactactttgaagccgctgcgcagatgagcaaagctgagcgtgaaaatctggtg
atttcagtgcctagtggcaactttggtaacttaaccgcagggctgttagccaaagcactg
ggtttaccggtgaagcgctttattgcggcaaccaatgccaacgatacagtgccacgttac
ttggaaacgggacgttgggaacccaaacccacggtagcaacaacgtcaaatgcgatggat
gtcagccaaccgaacaactggccgcgtatcgaagagctctgccaacgtatgggatggggc
ttagaaacgctgggcaaaggcgcggtttctgacgaggaaagtgcgcaagccgtacaagaa
ctttacgatctaggctacttgtgtgaaccgcatggttcgattgcttaccgtgtattggaa
gagcagcgccagccgcaagaaacggggctgttcttatgtaccgcgcatcccgccaaattc
aaagaagtggtggacgatattttaggtaccgacattgctctaccagcgccattggcaaaa
catgcggcgatggaattgctctcacaagagctgaatgccgatttcgcagcgctgcgtgcg
ttactggtgaatgtgaaataa

DBGET integrated database retrieval system