KEGG   Vibrio cholerae MJ-1236: VCD_002025Help
Entry
VCD_002025        CDS       T00903                                 

Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VCD_002025
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VCD_002025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1126031..1128151
Genome map
AA seq 706 aa AA seqDB search
MMFWDSEVAKRLLAQGALRPLDVQFARFIGKQAVLAGHNAAESELLSVLSAALSAELGRG
HICLPLCDAQGNRCDLAALIGLYGEASLQHSERWLAVDWQALLQASPLVGQQGEAVPLMF
DGSRLYLHRYWHYEKQLAARLTELAAPQRLSPAELANLRERLNTLFARDYLGLWQALQQK
PLSSVERIQLLNDRLDVVESDALDWPAIEAVVEKAQRAADLQALEQLIPLTHCLNWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALISQSMAQGKVPEIKLIAPTGKAAARLTES
MGKAVSQLAIEPEIAAAIPSSSSTIHRLLGAIPGSAEFRHHTRNPLHLDLLVVDEASMVD
LPLMVKLVEALPKHARLILLGDKDQLASVEAGAVLGDICTFLNQGYGHEQGAQLAELTGF
ATLRQTASKTVNPVADCLCMLQKSYRFDARSGIGQLAKAINSGSPARVEAVWQQSFSDIE
HFALSGEHYQQLLQTLVQAYRPYLSLLNQPTEQFESTQQSMLTLAKSALDAFSRCRLLCA
LREGDFGVMGLNTRIERALNAHKLIKTQEEIWYHGRPIMVTRNDHGLGLYNGDIGLCMRD
RDDDQGRLKVYFELPDGSIKAVLPSRVPQHETAYAMTIHKSQGSEFDLTLLILPPDYSPI
LTRELVYTGITRAKKQLKLYCDNKVLQRAIKVKTQRASGLVARLEQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttgggatagcgaagtagcgaaacgtctgctggcacaaggcgcgctgcgtcct
ttggatgtgcagtttgcccgctttattggcaagcaagccgtattggcagggcacaacgct
gcagaaagtgagcttttgagtgtactgagcgcggcgctcagtgcagaacttgggcgtgga
cacatctgtctgccactgtgtgatgcacagggtaatcgttgcgatctagcggcgctgatt
ggtctttatggtgaagcgagtttgcagcacagtgaacgctggttagcggtagactggcaa
gccttactgcaagcctcgccgttggtggggcagcaaggtgaagcggtgccgttaatgttt
gatggctcaaggctctatctgcatcgctactggcattatgaaaagcaactggcggcgcga
ttgactgagttggccgcaccccaacgtttaagccctgctgaactggctaacttgcgtgaa
cgcctgaataccttatttgcccgcgactatttaggcttgtggcaagcactacaacaaaag
ccgctaagttcggtcgagcggattcaactgctgaatgatcgattggatgttgtggagtcg
gatgcgctggattggccagcgattgaagctgtagtcgaaaaagcgcagcgtgccgcggat
ttgcaagctttagagcagcttattccgcttactcactgcttaaactggcaaaaagtggcg
gccgctgtcgctcttacccgccgttttgcggtgatttccggtgggccgggaaccggcaaa
accaccacagtgaccaagcttctggcggcgctgattagccaaagcatggcgcaaggtaaa
gtgccagagatcaaattgatcgctccaaccggtaaagccgcggcacggttaaccgaatcg
atgggtaaagcggtgagtcagctggcgatagagcctgagatcgccgcggcgatcccgagc
tcttccagcaccattcaccgtttgcttggcgcgattccgggcagcgctgagtttcgtcat
catacacgtaatccactccatcttgatctgttggtggtggatgaagcgtccatggttgac
ttgcctttgatggtgaaactggtcgaagcgctacccaagcacgctcggttgattttgctc
ggcgataaagatcaattggcttcggtggaagcgggggcggtgctcggtgatatttgtacc
ttcctgaaccaaggttacggccatgagcagggcgcgcagttggctgaactgacggggttt
gccactctgcgccaaactgccagtaaaacggtaaacccggtggcggattgcttatgtatg
ctgcaaaaaagctaccgttttgatgcgcgatctggcattggtcaattggcgaaagcgatc
aacagtggatctccggcgcgcgttgaagcggtgtggcaacagtcgttcagcgatattgaa
cactttgcccttagtggtgagcattatcagcaactgctgcaaaccttagtgcaggcttat
cgtccttatctgagcttgcttaatcagccaactgagcaatttgagtcgacccaacaaagc
atgctcacacttgccaaatcagcacttgatgcgttcagtcgctgccgattgctctgtgcg
ctgcgtgaaggcgattttggagtgatggggctgaacactcgcatcgaacgggcgttgaat
gctcacaagctgattaaaacgcaagaagagatctggtatcacgggcggccgatcatggtc
acgcgtaacgatcatggtttggggttatacaatggcgatattggcttgtgtatgcgcgat
cgtgacgatgatcagggcagactgaaagtctattttgagttgccggatggcagcattaaa
gccgtgttgccgagccgagtcccgcaacatgaaaccgcgtatgcgatgaccatacataaa
tcgcaaggcagcgaatttgatttaactttgctgattttaccgccggattacagtccgatt
ctgacgcgtgagttagtttacacggggatcacaagggcgaaaaaacagctcaaattgtat
tgcgataacaaggtattgcagcgagcaattaaagtgaaaacccaacgggcgagtggctta
gtggcaaggttggagcagtaa

DBGET integrated database retrieval system