KEGG   Vibrio cholerae MJ-1236: VCD_002068Help
Entry
VCD_002068        CDS       T00903                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VCD_002068
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VCD_002068
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    VCD_002068
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VCD_002068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1165228..1166406
Genome map
AA seq 392 aa AA seqDB search
MLKHRLLKFFSTEAIMTTNQRSIKAPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAEL
KKQGHSVVIVTSGAIAAGREHLGYPALPNAISSKQLLAAVGQSRLIQVWESLFAIYGIKI
GQMLLTRADLDDRERFLNARDTINALVENGIVPVVNENDAVATNEIKVGDNDNLSALVGI
LCGADKLLLLTDQKGLFTADPRKDPNAQLIKEVTTIDDTLRKIAGGSGTTLGTGGMATKL
QAADIARRAGIEVIIAAGRAPNVIFDSLSDEPQGTRFLALEEALENRKRWILAGPAASGD
IVIDDGAVKAVQTKGSSLLAKGVVRVQGQFARGEVVRVLDKQSHLIARGIAAYSNDELAQ
IAGKHSKEIIDILGYDHGSEVIHRDDMVVIQE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaacatcgtctcttaaagtttttctcaacagaagcaatcatgaccacaaatcaa
cgaagcatcaaagctccacaaacggttgttgtgaagctgggaaccagtgttctgaccggc
ggtactcttgcgctggatcgtgctcatatggttgagctcgctcgccagtgtgctgaactc
aaaaagcaaggtcactcagtagtgatcgtgacctcgggcgccattgcggctggccgtgag
catttaggttaccctgcgctgcccaacgcgatttccagcaagcaactgctggcagcggtt
gggcaaagtcgtttgattcaggtctgggaatcgttatttgcgatttatggcatcaaaatt
ggtcagatgctgctcacccgtgctgatcttgatgaccgtgagcgtttccttaatgcgcgt
gacaccatcaatgcgttagttgaaaatggcattgtgcctgtggtcaacgaaaacgatgcg
gtagcaaccaatgaaatcaaagtcggtgacaacgataacttatcggcgctggtcggtatt
ttgtgtggtgcggataagctgctgctgttgaccgatcaaaaaggcttgttcaccgccgat
ccgcgtaaagatcccaatgcccaactgatcaaagaagtgaccaccattgatgacacactg
cgcaaaattgctggtggcagtggcactacactcggtacgggcggcatggccaccaagctg
caagcggcggacattgctcgtcgtgctggtattgaagtcatcattgcggcaggtcgtgcg
cccaatgtgatttttgactccttaagtgatgagccacaaggcacgcgcttcttagctttg
gaagaagcgttagaaaaccgcaaacgctggattttggcaggcccagcggcatcaggcgat
attgtgattgacgatggcgcagtgaaagcggtgcaaaccaagggcagcagcttgctcgcc
aaaggtgtggtgcgagtgcaaggtcagttcgcccgtggtgaagtggtgcgggtactggat
aagcaaagtcatctgattgcgcgcggcatcgcggcctactccaatgacgagttggcgcaa
attgctggtaagcacagtaaagagatcatcgatattttaggctacgatcacggctcagaa
gtgatccaccgcgacgacatggtcgtgattcaagagtaa

DBGET integrated database retrieval system