KEGG   Vibrio cholerae MJ-1236: VCD_002176Help
Entry
VCD_002176        CDS       T00903                                 

Definition
phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
vcj  Vibrio cholerae MJ-1236
Brite
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     VCD_002176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1281706..1282293
Genome map
AA seq 195 aa AA seqDB search
MKITKKIWCSVAAVISLITGGAIVGQEYVQPVGQVVIEGQALGELRISPKGLEMTGNAEG
CRLDPYTCPSGLVTNGVGNTHGVPDNPVSLEQVAKDWVRNLQEAERCVESVERASGKPMT
QGQFDAFTSFAFNTGCQRYKRNSNRTATQIYRLSLEGNYPQACAELKRWVYGGGVKQPGL
IIRRNVEYERCMALD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactaaaaaaatttggtgctcagtcgccgccgtgatcagccttatcacgggc
ggggcgatagtcggccaagaatacgtacagccagttggtcaagtggtgatcgaaggccaa
gcccttggtgaactacgcatcagcccaaaagggctagaaatgacaggcaatgcagaaggg
tgtcgtttagacccgtacacctgcccatccggtttagtgaccaacggcgtgggcaacact
cacggcgtgcccgataaccccgtaagccttgagcaagtcgccaaagattgggtgaggaac
ctgcaagaagcagaacgctgcgtggaaagtgtcgaacgcgcctcaggcaaacccatgaca
caaggccagttcgatgcgttcacctcctttgcctttaacaccgggtgccagcgctacaaa
cgcaacagcaaccgcacagcaacgcagatttatcggttaagccttgaggggaactacccg
caagcctgtgcagagctcaaacgctgggtgtatggcggcggagtaaaacagccgggatta
atcattcgacggaatgtggaatatgaacgctgcatggcactggattaa

DBGET integrated database retrieval system