KEGG   Vibrio cholerae MJ-1236: VCD_002277Help
Entry
VCD_002277        CDS       T00903                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCD_002277
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VCD_002277
   00650 Butanoate metabolism
    VCD_002277
  Energy metabolism
   00190 Oxidative phosphorylation
    VCD_002277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1375392..1375736
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDYLLIRASAIILVLYTIYIVSFCAFTDISYVAWTQFFGSTFTKVFT
MLALVSVLIHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcatgtctcttcctttggtcgtaatggtgttcacgattacttattgatccgc
gcttcagcgatcatcttagttttgtacactatttatatcgtgagtttttgcgcgttcacg
gacatctcttatgtcgcgtggactcaattctttggtagcacgttcaccaaagtcttcaca
atgttggcattagtttcagtattgattcatggctggattggcctatggcaagtactgacg
gattacattaagtgctccaaattgcgtgcaggactgcaacttgtggtcatcgccgttcta
cttggatacttcttctctggcctatttgtattgtggggtgcctaa

DBGET integrated database retrieval system