KEGG   Vibrio cholerae MJ-1236: VCD_002277Help
Entry
VCD_002277        CDS       T00903                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
vcj00020  Citrate cycle (TCA cycle)
vcj00190  Oxidative phosphorylation
vcj00650  Butanoate metabolism
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01120  Microbial metabolism in diverse environments
vcj01130  Biosynthesis of antibiotics
vcj01200  Carbon metabolism
Module
vcj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vcj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vcj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VCD_002277
   00650 Butanoate metabolism
    VCD_002277
  Energy metabolism
   00190 Oxidative phosphorylation
    VCD_002277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACQ60444
Position
1:1375392..1375736
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDYLLIRASAIILVLYTIYIVSFCAFTDISYVAWTQFFGSTFTKVFT
MLALVSVLIHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcatgtctcttcctttggtcgtaatggtgttcacgattacttattgatccgc
gcttcagcgatcatcttagttttgtacactatttatatcgtgagtttttgcgcgttcacg
gacatctcttatgtcgcgtggactcaattctttggtagcacgttcaccaaagtcttcaca
atgttggcattagtttcagtattgattcatggctggattggcctatggcaagtactgacg
gattacattaagtgctccaaattgcgtgcaggactgcaacttgtggtcatcgccgttcta
cttggatacttcttctctggcctatttgtattgtggggtgcctaa

DBGET integrated database retrieval system