KEGG   Vibrio cholerae MJ-1236: VCD_002304Help
Entry
VCD_002304        CDS       T00903                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vcj02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vcj02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1410179..1411312
Genome map
AA seq 377 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGKEAVEKAARLKPDVITMDIEMPV
MDGISAVREIMANNPVPILMFSSLTHDGAKATLDALDAGALDFLPKKFEDIARNRDEAVT
LLQQRVLSIASKKMFLRRPAAPRPAPTTSIAASSSLSQERAAATSPLGNRPSTAVSAATR
FKASGKKYQLTAIGTSTGGPVALQKILTKLPVNYPHPIVLIQHMPATFTAAFASRLNSLC
KIEVKEAEDGDMLRPGVAYLAPGGKQMMLDGRPGAARLRIIDGGDRMNYKPCVDVTFGSA
AKIFGDKVLSMILTGMGADGREGARMLKQAGATIWAQDEESCVVYGMPQAVAKAGISTED
LPLERIAERMLVEVGLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtattagttgttgatgattcgagttttttccgtcgtcgcgtgagtgaa
atcatcaactccgaatcgcgcttagaagtcattgatgttgctgtaaatgggaaagaggcc
gtagaaaaggccgctcgactcaagccagatgtgatcactatggatatagaaatgcccgtc
atggacggtatttccgctgtccgagaaatcatggcaaacaatcccgtgcccattttgatg
ttctcttcattgacccatgatggcgcaaaagccacattggatgcactggatgctggcgcg
ttagactttttacctaagaagtttgaagatatcgcgcgcaaccgggatgaagccgtcaca
ctgttacagcagcgtgtgctttctattgcatcgaaaaagatgtttctacgtcgccctgca
gctccacgccctgcgcctacaacatcaatagcagcgagttcgtcactcagccaagaacga
gcggcagctacctcacctttgggaaaccgaccctcgacggcggtttcagcagccactcgt
tttaaagcttcgggtaaaaaataccagttgaccgcaataggaacctcaaccggtggacct
gtagccttgcaaaaaatattaactaagctccccgtaaattatccacaccccatagtgttg
attcagcatatgccagcaacatttacggctgcttttgctagccgtctcaattcgctatgc
aaaattgaagttaaagaagcggaagatggagatatgctgcgtccgggtgttgcttattta
gcaccgggtggtaagcagatgatgctggatggtcgacccggtgcggctcgcctacgtatt
atcgatggtggcgaccgcatgaactataaaccgtgtgtggatgttacttttggctccgca
gcgaaaatctttggtgacaaagtactgtccatgattttgaccggaatgggtgcggatgga
cgtgaaggtgcgcggatgctgaaacaagcaggagccaccatttgggcacaagatgaagaa
agttgtgtcgtgtatggcatgccacaagctgtcgctaaagcaggaatttcaacggaagat
ctaccgctggagagaatcgcagagcgtatgttggtagaagtcgggctcgcctaa

DBGET integrated database retrieval system