KEGG   Vibrio cholerae MJ-1236: VCD_002687Help
Entry
VCD_002687        CDS       T00903                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VCD_002687
  Lipid metabolism
   00561 Glycerolipid metabolism
    VCD_002687
   00600 Sphingolipid metabolism
    VCD_002687
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VCD_002687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1842751..1843875
Genome map
AA seq 374 aa AA seqDB search
MSHLRLANGREILVQQADIELEIAGNELFARYIGLHNRPFERRYPLFSTLLDVESDARLV
GDGFQMLSQASGTLSHIQEVGRCPDNNLSYRIYPHDAPKRFYNTLMIEAAGRYLLFGFTS
CQRFAGFFEVHRHPQHWVLSAFIDGEETRPQDWITNQLESVICLEGESMSELYQAYAEAI
SRQHPPRPHLKDPAPMGWCSWYAYYAEVTEQDIKENVAILAERHPELEWVLLDDGYQAFM
GDWLTPSQKFPSGIEQVIADIRAQGKKPAIWLAPFIAEADSAVFRQHPDWFVKNAAGQPL
KAEEITYGGWRCTPWYVLDCSHPDVQEHLTQVVKTLREEWGVELFKLDANYWGTLQGQRF
QSGVTGVEAYRMGM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagccatctcagattagcgaatgggcgagaaatcctagtgcagcaagcggatattgag
ctggagatcgcaggcaatgagctttttgcacggtatatcgggttacacaatcgacctttt
gagcgccgttatccactgtttagcactttactggatgtcgaatcggatgcccgcttagtg
ggggatgggtttcaaatgctgtcgcaagcctcaggtacgctaagccatatccaagaagtt
ggacgatgcccagataacaatctcagttaccgcatctatccgcatgatgcgccaaagcgt
ttttacaataccttgatgatagaggccgctggccgctatctgttgtttggctttacttct
tgccagcgttttgcgggcttttttgaagtgcaccgtcacccgcagcattgggtgttaagc
gcgtttattgatggagaggaaacccgcccacaagactggatcaccaatcagttggaatcg
gtgatttgcttagaaggcgagtccatgtcggagctttaccaagcctatgccgaggcgatt
tctcgccagcatccgccaagaccccatctcaaagatcccgcaccaatgggctggtgttct
tggtacgcttattatgcagaggtgaccgagcaagatatcaaagagaatgtcgcgatattg
gcggagcgtcacccagaattggaatgggtgctgctggatgacggctatcaagcctttatg
ggcgattggcttacgccatcccaaaaattccccagtggtattgagcaagtgattgccgat
attcgcgcacaaggtaaaaagcccgctatctggcttgccccttttatcgcggaagcggat
tcggcagtttttcgtcagcacccagactggtttgtgaaaaatgccgcaggtcagccactc
aaagccgaagagatcacttatggcggttggcgttgtactccttggtatgtgttggattgc
tctcatcctgacgtgcaagagcatttgacccaagtggtcaaaaccttacgtgaagagtgg
ggcgttgaactgtttaagctggatgccaactactggggaacgctacaaggccagcgtttt
caatccggtgttacgggtgtagaagcgtatcgaatgggcatgtaa

DBGET integrated database retrieval system