KEGG   Vibrio cholerae MJ-1236: VCD_002817Help
Entry
VCD_002817        CDS       T00903                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCD_002817
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VCD_002817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1994566..1996002
Genome map
AA seq 478 aa AA seqDB search
MAKSIFPNDFLWGGAVAAHQVEGGWDQGGKGVSIVDVLTRGAHEVPRRITDGVMEDEFYP
NHQAVDFYHHYKEDIALFAEMGFKCFRTSIAWTRIFPNGDEAEPNEAGLQFYDDLFDELL
KHNIEPVITLSHFEMPLHLVKQYGSWLNRDLIDHFTKFAQVVMTRYQHKVKYWITFNEIN
NQCNWKLPIFGYCNSGMLYAEQDRPEQAMYQVLHHQFIASALVVKLGHEINPDFKIGSMI
HMMPLYPATSRPEDVLLAQELMREKYLFSDVQVRGYYPSYLRKEWQRKGIEIEMQAGDEQ
ILRQGCADYLAISYYMTNIVSAAPEQEGETTSLFETSRLNPYLPASDWGWQIDPQGLRYA
LSELYERYQKPIFVVENGLGALDTVEADGSINDDYRIRYLSEHIAAVKQAIDYDGVEVMG
YTPWGCIDCVSFTTGEYKKRYGFIYVDKHDDGSGTMARAKKKSFYWYQQVIASNGEKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtctatttttcctaacgattttttgtggggtggtgcggtagcggcgcatcaa
gtggaaggcggttgggatcaaggtggtaaaggcgtgagcattgttgatgtgctgactcgt
ggtgcgcacgaagtgccacgccgtattaccgatggggttatggaagacgaattttaccca
aaccatcaagcggtcgatttttatcatcactataaagaagatatcgcgctgtttgctgag
atgggttttaaatgtttccgtacgtctattgcgtggacacggattttcccgaatggcgat
gaagccgagcccaatgaagcaggattacagttttatgatgatctgtttgatgagctgtta
aagcacaatattgaacctgtcattacgttgtcacattttgaaatgccactgcatctggta
aagcagtatggcagttggctcaaccgcgacttgattgatcacttcaccaaatttgcgcaa
gtcgtgatgacccgttaccagcataaggtgaaatactggatcacctttaatgaaatcaat
aaccaatgcaactggaagctgccgatctttggttattgcaactcaggtatgctttacgct
gagcaagaccgcccagaacaagccatgtaccaagtgctacatcaccaatttattgccagc
gcattagtggtgaaactggggcacgagatcaatccggattttaaaattggcagcatgatc
catatgatgccgctgtatcctgccacctcacgtccggaagatgtgttgttggcacaagag
ttgatgcgtgagaaatatctgttcagtgacgtacaggttcgtggctattaccccagttat
ctgcgcaaagaatggcaacgcaaaggcatcgaaattgagatgcaagctggtgatgagcag
atcctgcgccaaggctgcgccgattatctcgccatcagctactacatgaccaacattgtc
tctgcagcgccagaacaagagggcgaaaccacctctttgtttgaaaccagccgcttaaac
ccgtatcttcctgcgtccgattggggatggcagattgatccacaaggtttacgttatgcg
ctttctgagttgtatgagcgttaccaaaaaccgatttttgtggtagaaaatggcctcggc
gcgctagacaccgtcgaagcggatggttcaatcaacgatgattaccgaattcgctacctc
tctgagcatatcgcggcagtcaaacaagcgatcgactatgacggtgttgaagtgatgggt
tacaccccttggggctgtatcgactgtgtatcgttcaccactggcgagtacaaaaaacgc
tacggctttatctatgtggataaacacgatgatggcagtggcaccatggcgcgcgctaag
aaaaagagcttctactggtatcaacaagtgatcgccagtaacggtgaaaagctttaa

DBGET integrated database retrieval system