KEGG   Vibrio cholerae MJ-1236: VCD_002944Help
Entry
VCD_002944        CDS       T00903                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VCD_002944
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VCD_002944
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VCD_002944
Two-component system [BR:vcj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   VCD_002944
Bacterial motility proteins [BR:vcj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VCD_002944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2151786..2152862
Genome map
AA seq 358 aa AA seqDB search
MKILVVDDSALMRTTISDILQNIPNAEIKTARDGMDAIDKVMKWQPDVMTLDINMPNMDG
LTCLTQIMVERPLPIVMLSSLTHEGAITTLEALYLGAVDFVAKPGGTICGRLQEVAPLIR
EKVRAAAKMRVKVHTQLSVSPAEVEHKHKSPVVENNEDHQLAIMGVSTGGPGTVETILRH
LPADFSLPIIVNQHMPESFTAAFAQRLNRHLQQPVKEINRALVLEAGTVYVCKGDRDCIV
TLRDGKLAAMPTPNDSHFSWHPSVSKLVASAIRTCGEDNLLCVMLTGMGDDGATEMAQVA
QGNGIVFAQEPTTCVVPSMPEALLKRVPHIPTGTPEHLAYLMTEVVRQSSRELHYGNH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagttgtcgatgattctgcgttaatgcgcaccaccattagcgacatattg
caaaacattccgaatgccgagattaaaacagcacgtgatggtatggatgccatcgacaaa
gtgatgaaatggcaaccggatgtgatgacgttagacatcaatatgcccaacatggatggt
ctaacttgccttacgcaaatcatggttgaacgtcccttgccgattgtcatgctctcatcc
ctcacccatgaaggtgccattacaacgctcgaagcgctttatcttggtgcggtagacttt
gtcgccaaacccggaggcactatctgcggtcgattacaagaagtcgcaccactgatccgt
gaaaaagttcgcgcggcagcgaaaatgagagtcaaagttcacacgcagctttcggtatca
ccagcagaagtagagcacaaacataagtcacctgtggtggaaaataatgaagaccaccag
cttgcgatcatgggggtttcgacaggagggcccggcactgttgaaacgatactgcgccat
ctgcccgccgatttctcattacctattattgttaaccaacacatgccagagagcttcact
gccgcctttgcacaaaggcttaatcgccatctgcaacaacccgtgaaagagattaaccgt
gctttagtgcttgaggctggtaccgtttatgtttgcaagggtgaccgagactgcattgtc
acgctacgtgatggtaaattggctgccatgcccacgccaaatgatagccatttttcatgg
catcccagcgtctccaaactggttgccagcgccatacgcacttgtggagaagataactta
ttgtgcgtcatgctaacgggaatgggcgacgacggtgccactgaaatggctcaggttgct
caaggaaacggtattgtttttgcccaagaacccacaacctgcgtagtccccagtatgccg
gaagcattacttaaacgtgtaccccatattccaacaggaactccagagcacttagcttat
ctgatgaccgaagtggtgagacagtccagtagggagcttcactatggcaatcattaa

DBGET integrated database retrieval system