KEGG   Vibrio cholerae MJ-1236: VCD_003286Help
Entry
VCD_003286        CDS       T00903                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VCD_003286 (recR)
DNA repair and recombination proteins [BR:vcj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VCD_003286 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2538017..2538619)
Genome map
AA seq 200 aa AA seqDB search
MRTSHMLEHLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQEC
RTFTEQDVCHICSNPKRKENGQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLDGIGP
SDIGLDTLDYRLQRGDISEVILATNPTVEGEATAQYIAELCREHQVTASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcacatgctggaacatttgatggaagcattacgctgcctgccgggcgtt
ggcccaaaatcagcgcagcgtatggcattccatctgttacagcgcgatcgtaaaggtggt
ttacaactggctgaggcactgagtcaggcgatggtcgaaatcggccattgccaggaatgc
cgaacttttactgagcaggatgtttgccacatctgtagcaacccaaaacgtaaagaaaat
ggtcagttgtgtgtggttgaaagcccagcagatattgcggcgctagaagctaccggtcaa
ttttctggtcgctattttgtgttgatggggcacttatcaccgctggatggtattggcccg
agcgatattggcctcgatacgctggattatcgcttgcaacgcggtgatatcagtgaggtg
atcctcgccactaacccgacggtggaaggtgaggcgaccgcgcaatacattgccgagttg
tgtcgtgagcatcaagtcaccgcaagccgcattgcacatggtgttcccgtgggcggcgaa
cttgagttggtggatggcacgaccttatcccattcgctgttgggccgtcacaaactgttt
taa

DBGET integrated database retrieval system