KEGG   Vibrio cholerae MJ-1236: VCD_003591Help
Entry
VCD_003591        CDS       T00903                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
vcj00620  Pyruvate metabolism
vcj00630  Glyoxylate and dicarboxylate metabolism
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01120  Microbial metabolism in diverse environments
vcj01200  Carbon metabolism
Module
vcj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCD_003591
   00630 Glyoxylate and dicarboxylate metabolism
    VCD_003591
Enzymes [BR:vcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VCD_003591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACQ61747
Position
1:complement(2873192..2874853)
Genome map
AA seq 553 aa AA seqDB search
MSVSRKEFMSINTAELTQHTTETKITQGKLAVVGTLSPEHQAIFPVEAQTFLQQLCERFA
PRVDELLTLREQKQTLIDQGQLPDFLPETKDIREGSWKILGIPDDLQDRRVEITGPTDRK
MVINALNANVKVFMADFEDSMSPAWDKVLDGQINLRDAILGSISYTNPDNGKRYELNANP
AVLICRVRGLHLKEKHVTYNGLAIPGSLFDFALYFYNNHRALLKKGSGPYFYLPKLQAYQ
EAQWWSDVFHFTEDYFGLDTGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRWDYI
FSYIKTLKKHPDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPA
LNEQVLQKIRGDKMLEATNGHDGTWVAHPGLADTAMAVFNEVLGERKNQLNVSRMADAPI
TAAELLAPCDGSRSEHGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQ
WIQHGKTLDNGQVVTNELFRDYLKQEIEVVKSEVGESRFAQGRFTEAAELMERLTTSQEL
PNFLTIPGYDYLP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtttcaaggaaggaatttatgtcaatcaatactgctgaattaacccaacacacc
acggaaaccaaaatcacccaaggcaagcttgctgttgtgggtaccctttcacccgaacat
caagcgattttccctgtcgaagcccaaacttttttacagcaactctgtgagcgctttgcg
ccgcgagtggatgaattactgaccttgcgtgaacaaaaacaaacgcttatcgaccaaggc
cagctacctgattttcttcctgaaaccaaagatatccgtgaaggaagctggaagattctc
ggcattccagacgatctgcaagatcgtcgcgtagagatcacggggccaaccgatcgcaaa
atggtgattaatgcactgaacgcgaatgtgaaagtctttatggctgactttgaagattcg
atgtcgcccgcgtgggataaggtgttggatgggcagatcaacctgcgtgatgcgattctg
ggcagcataagctataccaacccagacaatggcaagcgttatgagctcaatgccaaccca
gcggtgctcatctgccgcgtgcgcggtctgcatctcaaagaaaaacatgtcacctacaac
ggcttggcgattcccggttcactgttcgattttgcgctctatttttacaacaaccatcgc
gcactattgaaaaaaggcagtggcccttatttctacctacctaagctgcaagcttatcaa
gaggcgcagtggtggagtgacgtgttccatttcacggaagattattttggcttagacaca
ggcaccatcaaagcaacggtgttgattgaaactctgcctgcggtatttcagatggatgag
atcctcttctcactcaaagagcacattgtcggtctgaactgtggacgctgggattatatt
ttcagctacatcaaaaccttgaaaaagcatcccgaccgcgtattgccggatcgccaagtg
gtgaccatggataagcctttcctcaatgcgtattcccgtttgttgatttacacctgtcat
aaacgcggcgcgtttgcgatgggcgggatggcggcgtttattccagccaaagatcctgcg
ctcaatgaacaagtgctacaaaaaattcgcggcgacaaaatgcttgaagcgaccaatggc
cacgatggcacttgggttgctcaccccggtttagcggataccgcgatggcggtgtttaac
gaagtgcttggtgagcgcaaaaaccaactcaatgtgagccggatggccgatgctccgata
accgcggccgagctattggcaccttgcgatggatcacgctctgagcatggcatgcgccac
aacattcgcgttgcgttgcaatacatcgaagcatggatttctggtaacggttgtgtgccg
atctacggcttgatggaagatgcggcgacagcggagatttcacgcgcttcgatttggcaa
tggatccaacacggcaaaacgttagataacgggcaagtggtcactaacgaactgtttcgc
gactacctcaaacaagagattgaggtggtgaaaagcgaagtgggtgagtcccgttttgca
caagggcgttttactgaagcggccgaattgatggagcgcttaacgaccagccaagagcta
ccgaatttcttaaccatacctggctacgactacttgccgtag

DBGET integrated database retrieval system