KEGG   Vibrio cholerae MJ-1236: VCD_003629Help
Entry
VCD_003629        CDS       T00903                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VCD_003629
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VCD_003629
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VCD_003629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(2922946..2923938)
Genome map
AA seq 330 aa AA seqDB search
MGPLWLDVAGYELSAEDREILQHPTVGGVILFGRNYHDNQQLLALNKAIRQAAKRPILIG
VDQEGGRVQRFREGFSRIPPAQYYARAENGVELAEQGGWLMAAELIAHDVDLSFAPVLDM
GFACKAIGNRAFGEDVQTVLKHSSAFLRGMKAVGMATTGKHFPGHGAVIADSHLETPYDE
RETIAQDMAIFRAQIEAGVLDAMMPAHVVYPHYDAQPASGSSYWLKQVLREELGFKGIVF
SDDLSMEGAAVMGGPVERSHQALVAGCDMILICNKREAAVEVLDNLPIMEVPQAEALLKK
QQFSYSELKRLERWQQASANMQRLIEQFSE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctttggttggatgtggccggttacgaactgagtgccgaagatcgcgaaatt
ctgcagcaccctacagtgggtggtgtgattctgtttggtcgcaactatcacgataaccag
caattgctggcactcaataaagcgatccgtcaagcggcgaaaagaccgattttgattggt
gtcgatcaagaaggtggccgcgtgcagcgtttccgtgaaggcttttctcgcattccccct
gcgcagtattacgcgcgtgctgagaatggcgttgagcttgctgagcagggcggttggttg
atggcggcagagctgattgcacacgatgttgatttaagttttgcgcctgtgctcgatatg
ggctttgcgtgtaaagcgattggcaaccgtgcttttggtgaagatgttcaaactgtactt
aagcacagcagtgcttttctgcgcggcatgaaagccgtcggcatggcgaccacaggcaaa
catttccccggccatggcgcggtgattgccgattcgcatttagagaccccttacgatgag
cgggagacgattgcgcaagatatggcgattttccgtgcgcaaattgaggctggagtgcta
gatgccatgatgccagcgcatgtggtgtatccgcattacgatgctcaacctgcgagcggt
tcgagctactggctaaaacaagtgttacgtgaagaactcggctttaaaggcatcgtattt
tcggatgatttgagcatggaaggcgcagccgtaatgggggggccagttgagcgctcccat
caagctttggtcgccggttgtgacatgattttgatctgtaacaagcgtgaggcggcggtc
gaagtgctggataaccttccgatcatggaagtaccacaagctgaagcactgctgaaaaag
cagcaatttagctacagtgagctgaagcgtttagagcgttggcagcaagcgtcagccaat
atgcagcgcttaatcgagcagttctccgaatag

DBGET integrated database retrieval system