KEGG   Vibrio cholerae MJ-1236: VCD_003671Help
Entry
VCD_003671        CDS       T00903                                 

Definition
dihydrofolate reductase
Orthology
K18589  
dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
One carbon pool by folate
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VCD_003671
   00670 One carbon pool by folate
    VCD_003671
Enzymes [BR:vcj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VCD_003671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2972078..2972551
Genome map
AA seq 157 aa AA seqDB search
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactatcactaatggtagctatatcgaagaatggagttatcgggaatggccctgat
attccatggagtgccaaaggtgaacagctcctgtttaaagctattacctataaccaatgg
ctgttggttggacgcaagacttttgaatcaatgggagcattacccaaccgaaagtatgcg
gtcgtaacacgttcaagttttacatctgacaatgagaacgtattgatctttccatcaatt
aaagatgctttaaccaacctaaagaaaataacggatcatgtcattgtttcaggtggtggg
gagatatacaaaagcctgatcgatcaagtagatacactacatatatctacaatagacatc
gagccggaaggtgatgtttactttcctgaaatccccagcaattttaggccagtttttacc
caagacttcgcctctaacataaattatagttaccaaatctggcaaaagggttaa

DBGET integrated database retrieval system