KEGG   Vibrio cholerae MJ-1236: VCD_003671Help
Entry
VCD_003671        CDS       T00903                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vcj00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vcj00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2972078..2972551
Genome map
AA seq 157 aa AA seqDB search
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactatcactaatggtagctatatcgaagaatggagttatcgggaatggccctgat
attccatggagtgccaaaggtgaacagctcctgtttaaagctattacctataaccaatgg
ctgttggttggacgcaagacttttgaatcaatgggagcattacccaaccgaaagtatgcg
gtcgtaacacgttcaagttttacatctgacaatgagaacgtattgatctttccatcaatt
aaagatgctttaaccaacctaaagaaaataacggatcatgtcattgtttcaggtggtggg
gagatatacaaaagcctgatcgatcaagtagatacactacatatatctacaatagacatc
gagccggaaggtgatgtttactttcctgaaatccccagcaattttaggccagtttttacc
caagacttcgcctctaacataaattatagttaccaaatctggcaaaagggttaa

DBGET integrated database retrieval system