KEGG   Vibrio cholerae MJ-1236: VCD_003697Help
Entry
VCD_003697        CDS       T00903                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vcj  Vibrio cholerae MJ-1236
Brite
Enzymes [BR:vcj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VCD_003697
Secretion system [BR:vcj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VCD_003697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2998051..2998743)
Genome map
AA seq 230 aa AA seqDB search
MRKLSPIILALALSPLVQAEPVSEVSPVGKIDGMVSLPVTGMKAVESNGRIVFMSDSGRF
VIDGTLYDAWSKKPLTSLEEIREAGNTLDLSRLGLKMDDLNPLTLGEGKKKVVVFVDPRC
PHCHELLKQALPLTKEYTFQILPVPVLGPDSERQVRQLGCARDKKAATDALLNGRIGNLE
QDDACNLEPMQRTLVTAQILGIQGVPFIVANDGRISRGRPYDLSAWLEGR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactatctccaattattctggcgcttgcgctgtctccattggttcaagctgaa
cctgtgtctgaagtgtcgcccgttggcaaaattgacggcatggtttctttgccggtcacg
ggtatgaaagcggtcgaaagcaatggccgtattgttttcatgtcagacagtggccggttc
gtcattgatggcacgctctatgatgcctggtcgaaaaagccgcttaccagccttgaagaa
attcgtgaagcgggtaacacgctggacttaagtcgtcttggcttaaaaatggatgatttg
aatccactgacgctgggtgaaggcaaaaagaaagtggtggtctttgttgatccccggtgt
ccgcattgccatgagcttttgaaacaagccctaccgctaaccaaagaatacaccttccaa
atactccctgtgccagtgcttggtcctgattcagagcgtcaggttcgccagcttggctgt
gcgcgtgacaaaaaagcggccaccgatgcattgctgaatggccggattggtaacctagaa
caggatgatgcctgcaacttagaaccaatgcagcgtaccttggtgacggctcaaatcctg
ggcattcaaggtgtgcctttcatcgtcgccaatgatggtcgcatcagccgaggccgtcct
tatgatctttctgcttggttggaggggcgttaa

DBGET integrated database retrieval system