KEGG   Vibrio cholerae MJ-1236: VCD_003814Help
Entry
VCD_003814        CDS       T00903                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VCD_003814
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VCD_003814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3149046..3149549
Genome map
AA seq 167 aa AA seqDB search
MMLAYIAIGSNLGDPVAQAQLAIQQLTLLPKSRLIAASSLYSSTPMGPQNQPDYINAVAA
IETELTPLELLDCTQRIELEQGRVRKSERWGPRTLDLDIVLYGNEVIETERLTIPHYGMK
VREFVLYPLAEIAPNLTLPDGTEIQALLQQVPLNGLSIWHSPTSSKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgcctacattgcgattggcagtaatttgggcgaccctgtcgcccaagcacag
ctggccatacaacagcttactctcttaccgaagtcgcgccttatcgcggcttcatcgctc
tatagcagcactccgatggggccgcaaaatcagcctgattacatcaacgctgtcgccgcc
atcgaaaccgaattaacgccactggaattgctcgattgcacacaacgcattgagctagaa
caggggcgtgtccgtaaaagcgaacgatggggaccgagaaccctcgatctcgatattgtg
ctttacggcaatgaggtgatagagaccgagcgcctcaccattcctcactatggaatgaaa
gtacgtgaattcgtgctttacccgctcgcggaaatcgcaccaaatttaaccctcccagac
gggactgaaatccaagcgttattgcaacaagtaccgctcaatgggctcagcatttggcac
tcgccaacgtcgagtaaggactaa

DBGET integrated database retrieval system