KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0084Help
Entry
VCLMA_A0084       CDS       T01871                                 

Gene name
yhjA
Definition
Cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vcl  Vibrio cholerae LMA3984-4
Brite
Enzymes [BR:vcl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VCLMA_A0084 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:86338..87339
Genome map
AA seq 333 aa AA seqDB search
MKVVLTSLSLAISLSLAGYAFAASPRSEPVSPILPAQEIHIGKAELGKKLYFDPRLSKSG
FISCNSCHNLSMGGSDNLKTSIGHNWQQGPINSPTVLNSSLNIAQFWDGRAADLKEQAGG
PIANPGEMAFTHTLAIDVLQSIPAYVSEFRLVFGKPTLDIDQVTEAIAEFEKTLVTPYSR
FDQWLMGDDSAITAQELAGYELFKNSGCVACHNGSALGGNSFQKMGLIEPYQTNNKVEGL
SAVTGADADRFKFKVPTLRNVALTYPYFHDGEAATLKDAVDIMGRLQLGRKFTDDENGKI
VAFLHTLTGEQPSFALPILPPSNDNTPKPQPFD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgttcttacctcgctgagcttagcgatatccctctccctcgctgggtatgct
tttgcggcatcgccaagaagcgaacctgtttcccccattttacctgcgcaggaaatccac
attggaaaagccgagttgggtaaaaaactgtactttgatccgcgcttatccaagtcaggg
tttatctcgtgtaactcatgccataacttgagcatgggcggcagtgataacttaaaaacg
tccatcggtcataactggcaacaaggtccaatcaactcaccgactgtgctcaattccagt
ttgaatatcgcccaattttgggatggtcgagcggccgatctgaaagagcaggcgggtggg
ccgattgccaatccgggtgaaatggcttttacgcatacgttagccattgatgtgttgcaa
tcaatcccagcttacgtgagtgagtttcgtctagtgtttggtaagccaaccctcgatatc
gatcaagtgaccgaagcgattgcggagtttgaaaagaccttagtgaccccatactcacgt
tttgaccaatggttaatgggggatgatagcgcgataacggctcaagagctggcaggctat
gaattgtttaaaaactcgggctgtgtggcttgtcataacggcagtgcgttaggtggcaat
tcgttccaaaaaatgggtttgattgaaccgtatcaaaccaacaataaagtcgaaggactc
agtgcagtaactggcgctgacgccgatcgctttaaatttaaagtcccgacactgcgcaat
gtggcgttaacgtatccctacttccatgacggagaagcggccacgcttaaagacgcagtg
gatatcatggggcgtttacagctagggcgtaaatttaccgatgatgaaaacggtaagata
gtggctttcttgcataccttaacaggggagcaaccaagctttgctttacccattttaccg
ccatccaacgacaatacacctaagcctcagccttttgattag

DBGET integrated database retrieval system