KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0097Help
Entry
VCLMA_A0097       CDS       T01871                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vcl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:100713..101636
Genome map
AA seq 307 aa AA seqDB search
MFILMGKDRRERVDSMPGVERLSIDLMLEEAQYLANLGVPAIALFPVVNQDAKSLCAAEA
YNPEGLVQRAVRALKEHVPQMGVITDVALDPFTTHGQDGIIDEQGYVLNDETTEVLVKQA
LSHAQAGADVVAPSDMMDGRIGRIRQALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSS
ANLKGGNKKNYQMDPANSDEALHEVAMDINEGADMVMVKPGMPYLDVVRRVKTELQVPTF
AYQVSGEYAMHKAAIMNGWLKERETVFESLLCFKRAGADGILTYFAKEVAEWLAEDSAKA
AQFLPKK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtttattttgatgggtaaagatcgccgtgaaagagtcgattccatgccgggcgtagaa
cgtttatccatcgatttaatgctggaagaagcacagtatctcgctaacctcggtgtgcct
gcgattgctctgtttcctgtggtcaatcaggatgcgaaaagcctatgtgcagcagaagct
tacaaccctgaaggcttagttcaacgcgcagtgcgtgcgctgaaagagcatgtgccgcaa
atgggcgtgatcactgatgtggcactggatccattcacaactcatggacaagacggcatc
atcgatgagcaaggttatgtgttgaatgatgaaacaacggaagtgctagtgaagcaagca
ctgtcgcatgctcaagctggcgcggatgtggttgccccttccgatatgatggatggccgt
attgggcgtattcgtcaagcattggaagaggcggggtacattcatactcaaatcatggct
tattccgctaaatatgcctcgaattactatgggccatttcgtgatgcggtcggttcatct
gcgaatttaaaaggtggcaacaagaagaactaccaaatggatcccgccaattccgatgaa
gctttgcatgaagtcgcgatggacatcaatgaaggcgcggacatggtgatggtgaagccc
ggcatgccctatctagatgtggtgcgccgtgtcaaaaccgagttgcaggtaccgaccttc
gcttaccaagtttccggtgagtatgcgatgcacaaagcggcaatcatgaatggttggttg
aaagagcgggaaacggtattcgaatctttactctgcttcaaacgtgcaggtgcagatggc
attttgacttactttgcgaaagaggtggctgagtggttggcggaagacagcgcaaaagct
gcgcaattcttacctaaaaaataa

DBGET integrated database retrieval system