KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0109Help
Entry
VCLMA_A0109       CDS       T01871                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vcl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(113758..114525)
Genome map
AA seq 255 aa AA seqDB search
MTVLVTRPDEQGAELCQLLHQQGIPALHHPLLAISASPQLAALAEDLSSFDIIIAVSQHA
VIFSDQFLQHRRICWPNNAIYLAVGQKTAHVFSKACQQSVDYPEISDSEHLLALSMLRDV
AGKKVLILRGNGGRELIYSTLVERGATVRYQEAYCRHERPFAAAECVQKWQLAKVDSLVI
TSSEQLAFFIRQFETSHLPWVQQLTLLVPSQRIATLAHQLGFHRIVVTLSAANRDLVAAL
MPEKPTGTLSNDQQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacagtactggtcactcgtcctgatgaacaaggcgcagagctgtgccaactgctgcac
cagcagggcatccccgccctgcaccatccgctgctcgccatctctgccagccctcaactt
gctgcgctggcagaagatttatcttcattcgatatcatcattgccgtcagtcaacatgcc
gtcatcttcagtgaccaatttctgcaacatcgccgaatttgttggccaaataacgctatt
taccttgccgttggtcaaaaaaccgcgcatgttttcagcaaagcctgccaacaatcagta
gactatccagaaataagcgatagtgaacatctgctggcactcagtatgctgcgggatgtt
gcaggtaagaaggtattgatcttacgtggtaatggtggtcgtgagctgatttattccacc
ttagtggaaagaggagcgactgtgcgctatcaagaagcgtattgtcgacatgagcggcca
tttgccgccgccgagtgtgtccaaaaatggcagttggcgaaggtcgactcactggtgatc
accagcagtgagcagttggctttttttatccgtcagttcgagacatcacacttgccatgg
gtgcagcagttaactttgctcgtccccagccaacggattgccactctcgcccatcaacta
ggatttcatcgcatcgtggtcacgctaagtgctgctaatcgcgatttagtcgcggcattg
atgcccgaaaaaccaacaggaactctgagcaatgaccaacaacaataa

DBGET integrated database retrieval system