KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0124Help
Entry
VCLMA_A0124       CDS       T01871                                 

Gene name
pldB
Definition
(GenBank) Lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VCLMA_A0124 (pldB)
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VCLMA_A0124 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 LCAT DLH Abhydrolase_5
Motif
Other DBs
NCBI-ProteinID: AEA77442
Position
I:complement(129482..130498)
Genome map
AA seq 338 aa AA seqDB search
MNPEKNLYPYTQESSLEQALNFEIAQVWHTRSEGTYRSFDKTHIYWCSLKHPEHQKAVVI
VNGRIESAWKYQELCYDLFRQGFDVYTYDHRGQGRSERLTEDRQIGHVHEFQDYVADLKA
LVEHFDLGHYQERFLLAHSMGGAIATRYIQTTPAHPFIALVLSAPMFGVNMPWYLRPWAS
LITQIMAAVTPKPSYAPGYGPYHAKPFHLNLLTHSETRYQLFRELYEAHPELQIGGPSHR
WVWQSLMATKQCLQLTRQIKIPMLILQAGEEAIVCNRAQNRLFKKLSRTQKRAALCRIAG
ARHELLFEQDAYRNQTLDHILRFFADSTIDHNRQHHRP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgaaaaaaatctttatccttatacgcaagagtcgagtttggagcaagctctc
aactttgagatagctcaagtgtggcacactcgaagcgaaggaacctatcgcagttttgat
aaaacgcacatttattggtgtagtctcaagcatcctgagcatcaaaaagccgtagtgatt
gtgaatggcaggattgaatctgcgtggaaatatcaagagctgtgttatgacctattccgc
caaggttttgatgtttatacctatgatcaccgtggtcaaggacggtcagaacgtctgact
gaagatagacaaataggccatgtgcatgaatttcaagattacgtagctgacctaaaagcc
ttagtcgagcatttcgatctcggtcactaccaagagcgctttttattagcccattctatg
ggtggcgcgattgctacgcgctatatccagaccactccagcgcacccctttattgcactg
gtcctgagtgctccgatgtttggcgtgaatatgccttggtatttaaggccatgggcttcg
ctcatcactcaaattatggccgccgttaccccaaaacccagttacgctccgggttatggc
ccttatcacgctaaaccctttcatctcaacctgctcacccacagtgaaacccgctatcag
ttgtttcgtgaactgtatgaagcgcaccctgaactgcaaattggagggccgagtcaccgc
tgggtttggcaaagcttaatggcgaccaaacagtgtttgcagttaacccgacaaatcaaa
atccccatgctgatcttacaagctggcgaagaagcgattgtgtgtaatcgggcgcaaaac
cggctcttcaaaaagctgtctcgcacccaaaaacgtgccgctttatgccgcatagcaggt
gccagacatgaactgctttttgaacaagatgcctaccgaaatcagacgttagaccatatt
ttgcgttttttcgccgacagtactatcgaccataacagacagcaccatcgaccatag

DBGET integrated database retrieval system