KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0353Help
Entry
VCLMA_A0353       CDS       T01871                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VCLMA_A0353
   00052 Galactose metabolism
    VCLMA_A0353
   00500 Starch and sucrose metabolism
    VCLMA_A0353
   00520 Amino sugar and nucleotide sugar metabolism
    VCLMA_A0353
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VCLMA_A0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(403283..404089)
Genome map
AA seq 268 aa AA seqDB search
MPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGKHSIMDHFDMNYELEHQIRGTNKE
ELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELVGDEPFAVVLADDLCVNEEQGVLA
QMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKDDLFRVDNMVEKPEPGTAPSNLAI
IGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKSGCVLAYKFKGKRFDCGSVEGYIE
ATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggtgttgatgaa
gcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaagcattcgatc
atggatcactttgacatgaactacgagttagagcaccaaatccgcggtacgaataaagaa
gagctattgggtgatatccgtaaaatcatcgaaagcgctaactttacttttattcgccaa
cgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtcggtgatgag
ccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggcgtactggca
cagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaagaggttcca
gaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagacgatctgttc
cgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaacctcgccatc
attggccgttatatcctcacgccagatatttttgatctgattgagcagaccgagccgggc
aaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaatcgggttgtgta
ctggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggctatatcgaa
gccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtggagttggct
aaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system