KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0516Help
Entry
VCLMA_A0516       CDS       T01871                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vcl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(575212..575715)
Genome map
AA seq 167 aa AA seqDB search
MMLAYIAIGSNLGDPVAQAQLAIQQLTLIPKSRLIAASSLYSSTPMGPQNQPDYINAVAA
IETELTPLELLDCTQRIELEQGRVRKSERWGPRTLDLDIVLYGNEVIETERLTIPHYGMK
VREFVLYPLAEIAPNLTLPDGTEIQALLQQVPLNGLSIWHSPTSSKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgcctacattgcgattggcagtaatttgggcgatcccgtcgcccaagcacaa
ctggccatacaacagcttactctcataccgaagtcgcgccttatcgcggcttcatcgctc
tatagcagcactccgatggggccgcaaaatcagcctgattacatcaacgctgttgccgcc
atcgaaaccgaattaacgccactggaattgctcgattgcacacaacgcattgagctagaa
caggggcgtgtccgtaaaagcgaacgatggggaccgagaaccctcgatctcgatattgtg
ctttacggcaatgaggtgatagagaccgagcgcctcaccattcctcactatggaatgaaa
gtacgtgaattcgtgctttacccgctcgcggaaatcgcaccaaatttaaccctcccagac
gggactgaaatccaagcgttattgcaacaagtaccgctcaatgggctcagcatttggcac
tcgccaacgtcgagtaaggactaa

DBGET integrated database retrieval system