KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0559Help
Entry
VCLMA_A0559       CDS       T01871                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VCLMA_A0559
Enzymes [BR:vcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VCLMA_A0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:634639..635475
Genome map
AA seq 278 aa AA seqDB search
MLKISHADKQLELHSPVVMGILNTTPDSFSDGGRYVDLDVALERAQQMIDFGVAIIDIGG
ESTRPGAPDVALEEELQRVIPLIKAIRKQNAEVWISIDTSKAEVMRQALAAGADLINDVR
ALQEPGALEVAAQAQVPVCIMHMQGQPRTMQANPHYDNIIEEVCQFLAERIAQCEAAGIK
RENIILDPGFGFGKSVQHNYHLLAHLEQFHRFGLPVLAGMSRKSMIFKTLNKQPAECVAG
SVACATLAAQKGAQIIRVHDVEQTIDALKMVQMMHNNL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaatcagtcatgccgataagcagcttgagctgcattcacccgttgtgatgggg
atcttaaatactacgccagactccttttctgatggtggccgttacgttgaccttgatgtc
gcgttggaaagagcacagcaaatgatcgactttggtgtcgcgattattgatattggtggt
gagtcaactcgaccaggcgctcctgatgtggctttagaagaggaattacagcgcgtcatc
ccacttatcaaagcgattcgaaaacagaatgctgaggtatggatttcgattgataccagc
aaagcggaagtgatgcgccaagcattagctgcgggagccgatctgattaatgatgtgcgt
gctttgcaagagccgggagctcttgaagtagcagcgcaggctcaagtcccggtttgtatt
atgcatatgcaaggtcagccgcggacgatgcaagctaacccacactacgacaatattatt
gaagaggtttgccagtttttagctgagcgaattgcacaatgcgaagctgcgggtattaag
cgtgagaatattatcttagatcccggttttggttttggaaaatcggtgcaacacaattat
catttgctcgcccatttagaacagtttcatcgttttggattgccagttttagctggaatg
tcacgtaaatcaatgatttttaaaacactgaataagcaacctgctgaatgtgtggcagga
agcgttgcgtgtgccacattggctgcgcaaaaaggcgcacaaattatccgtgttcatgat
gtagagcagaccattgatgcactcaaaatggtgcagatgatgcataacaatttgtaa

DBGET integrated database retrieval system