KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0577Help
Entry
VCLMA_A0577       CDS       T01871                                 

Definition
(GenBank) DNA polymerase III psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00230  Purine metabolism
vcl00240  Pyrimidine metabolism
vcl01100  Metabolic pathways
vcl03030  DNA replication
vcl03430  Mismatch repair
vcl03440  Homologous recombination
Module
vcl_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VCLMA_A0577
   00240 Pyrimidine metabolism
    VCLMA_A0577
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VCLMA_A0577
   03430 Mismatch repair
    VCLMA_A0577
   03440 Homologous recombination
    VCLMA_A0577
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VCLMA_A0577
DNA replication proteins [BR:vcl03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VCLMA_A0577
DNA repair and recombination proteins [BR:vcl03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     VCLMA_A0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi DUF3938
Motif
Other DBs
NCBI-ProteinID: AEA77863
Position
I:655242..655649
Genome map
AA seq 135 aa AA seqDB search
MLSSSHYLSAMDIQQWELIHPERLAGFQPRTQTLDHDCRLLLVANQPPQGAEILLLERIL
KSFQLELSMVRYIAPIQLSQLAYTGLEWIWFAGCDPLSHQAQKQLHSPRLSDIDGNTQYR
RALWQQICAHQGIAS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgctttcttcttcacactatttgtccgcgatggacattcaacaatgggaattgatccat
ccagagcgtttggccggatttcagccgcgcacacaaacgctggatcacgattgccgactc
ttgttggtggccaatcaaccgccacaaggcgcggaaattctgttgctggagagaattctc
aaaagctttcagcttgagctgtcgatggttcgctacatcgcaccgattcagctcagtcaa
cttgcctatactggactcgagtggatctggtttgcgggctgcgatcccttatctcatcag
gctcaaaaacagctgcattcgccgcggttgagtgacattgatggcaatactcaataccgc
cgcgcgttgtggcagcaaatttgcgctcatcaaggaatcgcatcatga

DBGET integrated database retrieval system