KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0612Help
Entry
VCLMA_A0612       CDS       T01871                                 

Definition
Beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VCLMA_A0612
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VCLMA_A0612
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VCLMA_A0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:692542..693534
Genome map
AA seq 330 aa AA seqDB search
MGPLWLDVAGYELSAEDREILQHPTVGGVILFGRNYHDNQQLLALNKAIRQAAKRPILIG
VDQEGGRVQRFREGFSRIPPAQYYSRAENGVDLAEQGGWLMAAELIAHDVDLSFAPVLDM
GFACKAIGNRAFGEDIQTVLKHSSAFLRGMKAVGMATTGKHFPGHGAVIADSHLETPYDE
RETIAQDMAIFRAQIEAGVLDAMMPAHVVYPHYDAQPASGSSYWLKQVLREELGFKGIVF
SDDLSMEGAAVMGGPVERSHQALVAGCDMILMCNKREAAVEVLDHLPIMEVPQAEALLKK
QQFSYSELKRSERWQQASANMQRLIEQFSE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctttggttggatgtggccggttacgaactgagtgccgaagatcgcgaaatt
ctgcagcaccctacagtgggtggtgtgattctgtttggtcgcaactatcacgataaccag
caattgctggcactcaataaagcgatccgtcaagcggcgaaaagaccgattttgattggt
gtcgatcaagaaggtggccgcgtgcagcgtttccgtgaaggcttttctcgcattccccct
gcgcagtattactctcgtgctgagaatggcgttgatctcgctgaacaaggcggttggttg
atggcggcagagctgattgcacacgatgtcgatttaagttttgcgcccgtgcttgatatg
ggctttgcgtgtaaagcgattggcaaccgcgcttttggtgaagatattcaaaccgtactt
aagcacagcagtgcttttctgcgcggcatgaaagccgtcggtatggcgaccacaggcaaa
catttccccggtcatggcgcggtgattgccgattcgcatttagagaccccttacgatgag
agagagacgattgcgcaagatatggcgattttccgtgcgcaaattgaagcgggagtgctg
gatgccatgatgccagcgcatgtggtatatccgcattacgatgctcaacctgcgagtggt
tcgagctactggttaaaacaagtgttacgtgaagaactcggctttaaaggcatcgtgttc
tctgatgatttgagtatggaaggcgcagccgtgatgggtgggccagttgagcgctcccat
caagccttggtcgcgggttgtgacatgattttgatgtgtaacaagcgtgaagcggcagtc
gaagtgctggatcacctaccgatcatggaagtgccgcaagccgaagcactgctgaaaaaa
cagcaattcagctacagtgagctgaagcgctcagagcgttggcagcaagcgtcagccaat
atgcagcgcttaatcgagcagttctccgaatag

DBGET integrated database retrieval system