KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0912Help
Entry
VCLMA_A0912       CDS       T01871                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VCLMA_A0912
DNA repair and recombination proteins [BR:vcl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VCLMA_A0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1027298..1027870
Genome map
AA seq 190 aa AA seqDB search
MEALRCLPGVGPKSAQRMAFHLLQRDRKGGIQLAEALSQAMVEIGHCQECRTFTEQDVCH
ICSNPKRKENGQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLDGIGPSDIGLDTLDY
RLQRKDISEVILATNPTVEGEATAQYIAELCREHQVTASRIAHGVPVGGELELVDGTTLS
HSLLGRHKLF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattacgctgcctgccgggcgttggtccaaaatcagcgcagcgtatggcattc
catctgttacagcgcgatcgtaaaggcggtatacaactggctgaggcactgagtcaagcg
atggtcgaaatcggtcattgtcaggagtgtcgaacctttaccgagcaggatgtttgccac
atctgtagcaacccgaaacgtaaagaaaatggtcagttgtgtgtagtcgaaagtccggca
gatattgctgcgttggaagcaaccggtcagttttctggtcgctattttgtgctgatgggt
cacctgtcaccactggatggtattggtccgagcgatattggcttggatactctggattat
cgcctacagcgcaaagacatcagtgaggtgatccttgccactaacccaactgtggaaggt
gaagccactgcgcaatacattgcggagttgtgtcgtgaacatcaagtgacagcgagccga
attgcccacggtgtccccgtggggggcgagctagagttggtggatggcacgaccttatcg
cattcgctgttaggtcgtcacaaactgttttaa

DBGET integrated database retrieval system