KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0912Help
Entry
VCLMA_A0912       CDS       T01871                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vcl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1027298..1027870
Genome map
AA seq 190 aa AA seqDB search
MEALRCLPGVGPKSAQRMAFHLLQRDRKGGIQLAEALSQAMVEIGHCQECRTFTEQDVCH
ICSNPKRKENGQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLDGIGPSDIGLDTLDY
RLQRKDISEVILATNPTVEGEATAQYIAELCREHQVTASRIAHGVPVGGELELVDGTTLS
HSLLGRHKLF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattacgctgcctgccgggcgttggtccaaaatcagcgcagcgtatggcattc
catctgttacagcgcgatcgtaaaggcggtatacaactggctgaggcactgagtcaagcg
atggtcgaaatcggtcattgtcaggagtgtcgaacctttaccgagcaggatgtttgccac
atctgtagcaacccgaaacgtaaagaaaatggtcagttgtgtgtagtcgaaagtccggca
gatattgctgcgttggaagcaaccggtcagttttctggtcgctattttgtgctgatgggt
cacctgtcaccactggatggtattggtccgagcgatattggcttggatactctggattat
cgcctacagcgcaaagacatcagtgaggtgatccttgccactaacccaactgtggaaggt
gaagccactgcgcaatacattgcggagttgtgtcgtgaacatcaagtgacagcgagccga
attgcccacggtgtccccgtggggggcgagctagagttggtggatggcacgaccttatcg
cattcgctgttaggtcgtcacaaactgttttaa

DBGET integrated database retrieval system