KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0987Help
Entry
VCLMA_A0987       CDS       T01871                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vcl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:vcl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1104173..1105468
Genome map
AA seq 431 aa AA seqDB search
MRTVVWQSLSEAQQESILERPAITEGANITAAVAQVIAKVRSEGDAALFELTEKFDRVKP
ASLRVSREEMDAAAARLSETMKQALEQAYNNISKFHKAQKVQPIKVETMPGVVCEQVTRP
INKVGLYIPGGSAPLPSTVLMLGVPAQIAGCRKVVLCSPPPIADEILYVAKLCNIDEVYN
LGGGQAIAAMAYGTETVTKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DETADANFIAADLLSQAEHGPDSQVVLVTPSPVLADQVTDAVQKQLKVLSRAGIAEKALA
SSLIIIAESLTQAVSISNYYGPEHLIVQTRNPRELVPLLDNAGSIFLGDWSPESVGDYAS
GTNHVLPTYGYTRTYSSLGLADFSKRMTVQELTADGLQLLAPTVVTMAEAEGLDAHKRAV
TIRVEKLQKAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgtggtttggcaatcgttgagtgaagctcagcaagaatcgattttagaacgt
cctgcgattacggaaggagcaaacatcaccgctgcggttgcgcaggtgattgcgaaagtg
cgcagtgagggtgatgctgccctgtttgaattaaccgaaaaatttgatcgcgtaaaaccc
gcttcactgcgcgtatctcgtgaagagatggatgccgcggccgcgcgtttgtcggaaaca
atgaaacaggcgttggagcaggcatacaacaacatcagcaaattccacaaggcgcaaaaa
gtgcagccaatcaaagtggaaaccatgcccggagtggtgtgtgagcaagtgactcgcccg
atcaataaagtgggtctgtatattccgggtggcagcgcaccgctaccatcaaccgtacta
atgctcggtgtgcctgcacaaatcgccggttgccgtaaagtcgtgctctgctcacctccg
ccaattgctgatgaaattctctacgtcgctaagctttgtaacatcgatgaggtgtacaac
ctaggcggcggtcaggcaatcgcggcaatggcttatggtacggaaacggtcactaaagtt
gacaaaatctttggccccggtaacgcctatgtgacggaagcaaaacgccaagtgagtaac
gattttcgcggcgcagcgattgatatgcctgcaggaccttcagaggtattggtgattgct
gatgaaacggcggatgccaattttatcgccgccgatctactcagtcaggcagagcacggc
ccagattctcaggtggtgttggtgacgccatctccggtgttagccgatcaggtcacggac
gcggtgcaaaagcagcttaaagtcctttcgcgcgctggcattgctgaaaaagcgttggct
tccagtctgattattattgctgaatcactcacccaagcggtgtcgatttctaactactac
ggccctgagcacttgattgtgcagacgcgcaacccgcgtgagttggttccactgctcgat
aatgcaggctccattttccttggcgattggtcgccagaatcggtaggcgattacgcttca
ggtactaaccatgtgctacccacttacggttacacccgcacctattccagcttaggctta
gccgatttcagcaaacgcatgacagtgcaagaactgaccgctgatggcttgcaattgctc
gcgcccaccgtagtcacgatggcggaagcggaagggttagacgcgcacaaacgtgcggtt
acgattcgagtagaaaaattacagaaggctcaataa

DBGET integrated database retrieval system