KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1023Help
Entry
VCLMA_A1023       CDS       T01871                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vcl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vcl00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vcl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1145060..1146250)
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEFGGQFVPQILVPALDQLEQAFIDAQQDDAFRAEFMSLLQEYAGRPTALTL
TQNITKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVHSGSATLKDACNEALRDWSASY
ETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGIEPAGKGIDTHQHGAPLKHGKTGIFFGMKAPLMQDEHGQVEESYSVS
AGLDFPSVGPQHAYLNAIGRAEYESITDDEALDAFQALARNEGIIPALESSHALAHAIKM
AYAEPDKEQLLVVNLSGRGDKDIFTVHKLLEDKGAL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaaacgcctattttggcgaattcggtgggcagtttgtgccacaaattttg
gttcccgcactcgatcaactggaacaagcttttattgatgcccagcaggatgatgctttt
cgcgctgaatttatgagcctactgcaagagtacgcgggtcgccccactgcgctaacgctc
acgcaaaacatcaccaaaggcaccaaaaccaaactctatttgaagcgcgaagatttgctg
cacggcggcgcgcacaaaaccaaccaagttttgggtcaagctctactcgccaagcgcatg
ggcaaacatgaaatcatcgccgagaccggcgcaggtcaacacggtgtggcgacggcatta
gcctgtgcactgcttggcctaaaatgccgcgtgtacatgggtgcaaaagacgttgagcgc
caaagcccaaacgtgttccgtatgcgcttaatgggtgccaccgtgatccctgttcattca
ggttcagcaacgctaaaagatgcctgtaacgaagcgctgcgtgactggtcagccagctat
gaaactgcgcattatctgctcggtactgcggcaggccctcacccattcccaaccatagta
cgtgaattccaacgcattattggcgaagaaaccaaaaaccaaatcctagcgcgtgaaggt
cgtttgcccgatgcggtgatcgcctgtgttggcggtggctcaaacgcgattggtatgttt
gccgatttcatcgaagaagaatcggtgcgtttgatcggtattgagccagcaggtaaaggc
attgatacccaccaacatggcgcgccacttaaacacggtaaaactggcattttcttcggt
atgaaagcgcccttgatgcaagatgaacatggtcaagtggaagagtcttactctgtctct
gcggggctggatttcccatcggtgggtccacaacatgcttacctgaatgccattggccgc
gccgaatacgaaagcattaccgatgatgaagcgcttgatgcgtttcaagcgttggcacgt
aacgaaggcatcattccagcgctggagtcttcacacgctctcgcacatgcaatcaaaatg
gcgtatgccgaaccagacaaagagcagttgctcgtggttaacctttcgggccgaggtgat
aaggatatcttcaccgtacacaaattacttgaagacaaaggagcgttgtaa

DBGET integrated database retrieval system